HLA-E Recombinant Protein

• Gene Name :

  Major histocompatibility complex, class I, E

• Gene Aliases :

  HLA class I histocompatibility antigen, alpha chain E; HLA-6.2; MHC class I antigen E; MHC class Ib antigen; QA1.

• Gene ID :

  3133

• Accession Number :

  NP_005507.3

• Reactivity :

  Homo sapiens|Human

• Target :

  Preferably binds to a peptide derived from the signal sequence of most HLA-A, -B, -C and -G molecules.

• Type :

  Protein

• Source :

  E.coli

• Sequence :

  GSHSLKYFHTSVSRPGRGEPRFISVGYVDDTQFVRFDNDAASPRMVPRAPWMEQEGSEYWDRETRSARDTAQIFRVNLRTLRGYYNQSEAGSHTLQWMHGCELGPDRRFLRGYEQFAYDGKDYLTLNEDLRSWTAVDTAAQISEQKSNDASEAEHQRAYLEDTCVEWLHKYLEKGKETLLHLEPPKTHVTHHPISDHEATLRCWALGFYPAEITLTWQQDGEGHTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPEPVTLRWKPASQPTIPI

• Purification :

  Affinity purified using IMAC.

• Assay Protocol :

  Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

• Concentration :

  Varies by lot. See vial for exact concentration.

• Format :

  Liquid or Lyophilized powder

• Buffer :

  If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

• Reconstitution :

  -20°C or -80°C

• Molecular Weight :

  48.7 kDa

• Protein Length :

  Recombinant

• NCBI Gene Symbol :

  HLA-E

• Host or Source :

  Human

• Protein Name :

  HLA class I histocompatibility antigen, alpha chain E

• Gene Name URL :

  HLA-E

• CAS Number :

  9000-83-3

• Nucleotide Accession Number :

  NM_005516.5