SCP2 Recombinant Protein

• Gene Name:

  Sterol carrier protein 2

• Gene Aliases:

  Acetyl-CoA C-myristoyltransferase; epididymis secretory sperm binding protein; NLTP; non-specific lipid-transfer protein; NSL-TP; propanoyl-CoA C-acyltransferase; SCOX; SCP-2; SCP-2/3-oxoacyl-CoA thiolase; SCP-2/thiolase; SCP-CHI; SCPX; SCP-X; sterol carrier protein 2; sterol carrier protein X; straight-chain acyl-CoA oxidase.

• Gene ID:

  6342

• Accession Number:

  NP_001007099.1

• Reactivity:

  Homo sapiens|Human

• Target:

  Mediates in vitro the transfer of all common phospholipids, cholesterol and gangliosides between membranes. May play a role in regulating steroidogenesis.

• Type:

  Protein

• Source:

  E.coli

• Sequence:

  MGFPEAASSFRTHQIEAVPTSSASDGFKANLVFKEIEKKLEEEGEQFVKKIGGIFAFKVKDGPGGKEATWVVDVKNGKGSVLPNSDKKADCTITMADSDFLALMTGKMNPQSAFFQGKLKITGNMGLAMKLQNLQLQPGNAKL

• Assay Protocol:

  Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

• Format:

  Liquid or Lyophilized powder

• Buffer:

  If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

• Reconstitution:

  -20°C or -80°C

• Molecular Weight:

  42.4 kDa

• Protein Length:

  Recombinant

• NCBI Gene Symbol:

  SCP2

• Host or Source:

  Human

• Protein Name:

  Non-specific lipid-transfer protein

• Gene Name URL:

  SCP2

• CAS Number:

  9000-83-3

• Nucleotide Accession Number:

  NM_001007098.2