RDH11 Recombinant Protein

• Gene Name:

  Retinol dehydrogenase 11

• Gene Aliases:

  Androgen-regulated short-chain dehydrogenase/reductase 1; ARSDR1; CGI82; HCBP12; HCV core-binding protein HCBP12; MDT1; prostate short-chain dehydrogenase reductase 1; Prostate short-chain dehydrogenase/reductase 1; PSDR1; RALR1; RDJCSS; retinal reductase 1; retinol dehydrogenase 11; retinol dehydrogenase 11 (all-trans/9-cis/11-cis) ; SCALD; SDR7C1; Short chain dehydrogenase/reductase family 7C member 1; short chain dehydrogenase/reductase family 7C, member 1.

• Gene ID:

  51109

• Accession Number:

  NP_001239579.1

• Reactivity:

  Homo sapiens|Human

• Target:

  Exhibits an oxidoreductive catalytic activity towards retinoids. Most efficient as an NADPH-dependent retinal reductase. Displays high activity towards 9-cis and all-trans-retinol. Also involved in the metabolism of short-chain aldehydes. No steroid dehydrogenase activity detected.

• Type:

  Protein

• Source:

  E.coli

• Sequence:

  PQIRKMLSSGVCTSTVQLPGKVVVVTGANTGIGKETAKELAQRGARVYLACRDVEKGELVAKEIQTTTGNQQVLVRKLDLSDTKSIRAFAKGFLAEEKHLHVLINNAGVMMCPYSKTADGFEMHIGVNHLGHFLLTHLLLEKLKESAPSRIVNVSSLAHHLGRIHFHNLQGEKFYNAGLAYCHSKLANILFTQELARRLKGSGVTTYSVHPGTVQSELVRHSSFMRWMWWLFSFFIKTPQQGAQTSLHCALTEGLEILSGNHFSDCHVAWVSAQARNETIARRLWDVSCDLLGLPID

• Assay Protocol:

  Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

• Format:

  Liquid or Lyophilized powder

• Buffer:

  If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

• Reconstitution:

  -20°C or -80°C

• Molecular Weight:

  49 kDa

• Protein Length:

  Recombinant

• NCBI Gene Symbol:

  RDH11

• Host or Source:

  Human

• Protein Name:

  Retinol dehydrogenase 11

• Gene Name URL:

  RDH11

• CAS Number:

  9000-83-3

• Nucleotide Accession Number:

  NM_001252650.1