PTPN5 Recombinant Protein

• Gene Name:

  Protein tyrosine phosphatase non-receptor type 5

• Gene Aliases:

  Neural-specific protein-tyrosine phosphatase; protein tyrosine phosphatase, non-receptor type 5 (striatum-enriched) ; protein-tyrosine phosphatase striatum-enriched; PTPSTEP; STEP; STEP61; striatal-enriched protein tyrosine phosphatase; striatum-enriched protein-tyrosine phosphatase; tyrosine-protein phosphatase non-receptor type 5.

• Gene ID:

  84867

• Accession Number:

  NP_001035059.1

• Reactivity:

  Homo sapiens|Human

• Target:

  May regulate the activity of several effector molecules involved in synaptic plasticity and neuronal cell survival, including MAPKs, Src family kinases and NMDA receptors.

• Type:

  Protein

• Source:

  E.coli

• Sequence:

  LQAEFFEIPMNFVDPKEYDIPGLVRKNRYKTILPNPHSRVCLTSPDPDDPLSSYINANYIRGYGGEEKVYIATQGPIVSTVADFWRMVWQEHTPIIVMITNIEEMNEKCTEYWPEEQVAYDGVEITVQKVIHTEDYRLRLISLKSGTEERGLKHYWFTSWPDQKTPDRAPPLLHLVREVEEAAQQEGPHCAPIIVHCSAGIGRTGCFIATSICCQQLRQEGVVDILKTTCQLRQDRGGMIQTCEQYQFVHHVMSLY

• Assay Protocol:

  Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

• Format:

  Liquid or Lyophilized powder

• Buffer:

  If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

• Reconstitution:

  -20°C or -80°C

• Molecular Weight:

  45.5 kDa

• Protein Length:

  Recombinant

• NCBI Gene Symbol:

  PTPN5

• Host or Source:

  Human

• Protein Name:

  RecName: Full=Tyrosine-protein phosphatase non-receptor type 5; AltName: Full=Neural-specific protein-tyrosine phosphatase; AltName: Full=Striatum-enriched protein-tyrosine phosphatase; Short=STEP|Tyrosine-protein phosphatase non-receptor type 5

• Gene Name URL:

  PTPN5

• CAS Number:

  9000-83-3

• Nucleotide Accession Number:

  NM_001039970.1