NKTR Recombinant Protein

• Gene Name:

  Natural killer cell triggering receptor

• Gene Aliases:

  Natural killer triggering receptor; natural killer-tumor recognition sequence; natural-killer cells cyclophilin-related protein; NK-TR protein; NK-tumor recognition protein; p104; peptidyl-prolyl cis-trans isomerase NKTR; PPIase; rotamase.

• Gene ID:

  4820

• Accession Number:

  NP_005376.2

• Reactivity:

  Homo sapiens|Human

• Target:

  PPIase that catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides and may therefore assist protein folding (PubMed:20676357) . Component of a putative tumor-recognition complex involved in the function of NK cells (PubMed:8421688) .

• Type:

  Protein

• Source:

  E.coli

• Sequence:

  HFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEKGLGKTTGKKLCYKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTDAASRPYADVRVIDCGV

• Assay Protocol:

  Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

• Format:

  Liquid or Lyophilized powder

• Buffer:

  If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

• Reconstitution:

  -20°C or -80°C

• Molecular Weight:

  34.4 kDa

• Protein Length:

  Recombinant

• NCBI Gene Symbol:

  NKTR

• Host or Source:

  Human

• Protein Name:

  NK-tumor recognition protein

• Gene Name URL:

  NKTR

• CAS Number:

  9000-83-3

• Nucleotide Accession Number:

  NM_005385.3