Products for Research Use Only
RegisterLogin

Kcne2 Recombinant Protein

CAT: 0247-OPCA01672-100UGSize: 100 µgDry Ice: NoHazardous: No
Product image 1
1 / 1
CAT#:0247-OPCA01672-100UGSize:100 µg
Selected
24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Quick Request Actions
CAS Number
9000-83-3
Gene Name
Potassium voltage-gated channel subfamily E regulatory subunit 2
Gene Aliases
Minimum potassium ion channel-related peptide 1; minK-related peptide 1; Mirp1; potassium channel subunit beta MiRP1; potassium channel, voltage gated subfamily E regulatory beta subunit 2; potassium channel, voltage-gated Isk-related subfamily E regulatory beta subunit 2; potassium voltage-gated channel subfamily E member 2; potassium voltage-gated channel, Isk-related family, member 2; potassium voltage-gated channel, Isk-related subfamily, gene 2.
Gene ID
171138
Accession Number
NP_598287.1
Reactivity
Rat|Rattus norvegicus
Target
Ancillary protein that assembles as a beta subunit with a voltage-gated potassium channel complex of pore-forming alpha subunits. Modulates the gating kinetics and enhances stability of the channel complex. Assembled with KCNB1 modulates the gating characteristics of the delayed rectifier voltage-dependent potassium channel KCNB1 (PubMed:19219384) . Associated with KCNH2/HERG is proposed to form the rapidly activating component of the delayed rectifying potassium current in heart (IKr) . May associate with KCNQ2 and/or KCNQ3 and modulate the native M-type current. May associate with HCN1 and HCN2 and increase potassium current (By similarity) . Interacts with KCNQ1; forms a heterooligomer complex leading to currents with an apparently instantaneous activation, a rapid deactivation process and a linear current-voltage relationship and decreases the amplitude of the outward current (By similarity) .
Type
Protein
Source
E.coli
Sequence
MTTLANLTQTLEDAFKKVFITYMDSWRRNTTAEQQALQARVDAENFYYVILYLMVMIGMFAFIVVAILVSTVKSKRREHSQDPYHQYIVEDWQQKYRSQILHLEDSKATIHENLGATGFTVSP
Assay Protocol
Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol
Format
Liquid or Lyophilized powder
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
-20°C or -80°C
Molecular Weight
18.4 kDa
Protein Length
Recombinant
NCBI Gene Symbol
Kcne2
Host or Source
Rat
Protein Name
Potassium voltage-gated channel subfamily E member 2
Gene Name URL
Kcne2
Nucleotide Accession Number
NM_133603.2

Related Products

CatalogName
OCOA03209-20UGKCNE2 Protein Lysate
ARP80911_P050-25ULKCNE2 Antibody - middle region
AAP80911-100UGKCNE2 Peptide - middle region (AAP80911)
ARP80911_P050KCNE2 Antibody - middle region (ARP80911_P050)
OAAB14840-400ULKCNE2 Antibody - C-terminal region
OPCA03278-100UGKCNK2 Recombinant Protein
OPCA03278-20UGKCNK2 Recombinant Protein
OPCA03278-500UGOPCA03278-500UG - KCNK2 Recombinant Protein
OCOA05298-20UGKCNN2 Protein Lysate
OCOA05260-20UGKCNH2 Protein Lysate

Alternative Products

CatalogName
E30P12570Recombinant Human KCNE2 Protein
RP206753KCNE2 Recombinant Protein (Rat)
RP144992KCNE2 Recombinant Protein (Mouse)
RP066336KCNE2 Recombinant Protein (Human)
PH36888M5KCNE2 (NM_172201) Human Recombinant Protein
E45M48980M5Kcne2 (NM_134110) Mouse Recombinant Protein
TMPH-01891-01KCNE2 Protein, Human, Recombinant (His)
QP6254-ec-1mgRecombinant Rat Kcne2 Protein, His, E.coli-1mg
QP6254-ec-200ugRecombinant Rat Kcne2 Protein, His, E.coli-200ug
QP6254-ec-100ugRecombinant Rat Kcne2 Protein, His, E.coli-100ug

Popular Products