Recombinant human Bis (5'-adenosyl) -triphosphatase

CAT:
247-OPCA00923-1MG
Size:
1 mg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
Recombinant human Bis (5'-adenosyl) -triphosphatase - image 1

Recombinant human Bis (5'-adenosyl) -triphosphatase

  • Gene Name:

    Fragile histidine triad diadenosine triphosphatase
  • Gene Aliases:

    AP3A hydrolase; AP3Aase; bis (5'-adenosyl) -triphosphatase; diadenosine 5',5'''-P1, P3-triphosphate hydrolase; dinucleosidetriphosphatase; FRA3B; Fragile histidine triad protein.
  • Gene ID:

    2272
  • Reactivity:

    Homo sapiens|Human
  • Target:

    Cleaves P (1) -P (3) -bis (5'-adenosyl) triphosphate (Ap3A) to yield AMP and ADP. Can also hydrolyze P (1) -P (4) -bis (5'-adenosyl) tetraphosphate (Ap4A), but has extremely low activity with ATP. Modulates transcriptional activation by CTNNB1 and thereby contributes to regulate the expression of genes essential for cell proliferation and survival, such as CCND1 and BIRC5. Plays a role in the induction of apoptosis via SRC and AKT1 signaling pathways. Inhibits MDM2-mediated proteasomal degradation of p53/TP53 and thereby plays a role in p53/TP53-mediated apoptosis. Induction of apoptosis depends on the ability of FHIT to bind P (1) -P (3) -bis (5'-adenosyl) triphosphate or related compounds, but does not require its catalytic activity, it may in part come from the mitochondrial form, which sensitizes the low-affinity Ca (2+) transporters, enhancing mitochondrial calcium uptake. Functions as tumor suppressor.
  • Type:

    Protein
  • Source:

    E.coli
  • Sequence:

    SFRFGQHLIKPSVVFLKTELSFALVNRKPVVPGHVLVCPLRPVERFHDLRPDEVADLFQTTQRVGTVVEKHFHGTSLTFSMQDGPEAGQTVKHVHVHVLPRKAGDFHRNDSIYEELQKHDKEDFPASWRSEEEMAAEAAALRVYFQ
  • Assay Protocol:

    Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol
  • Format:

    Liquid or Lyophilized powder
  • Buffer:

    If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
  • Reconstitution:

    -20°C or -80°C
  • Molecular Weight:

    20.7 kDa
  • Protein Length:

    Recombinant
  • NCBI Gene Symbol:

    FHIT
  • Protein Name:

    Bis (5'-adenosyl) -triphosphatase
  • Gene Name URL:

    FHIT
  • CAS Number:

    9000-83-3