Recombinant human MYL2

• Gene Name:

  Myosin light chain 2

• Gene Aliases:

  Cardiac myosin light chain 2; cardiac ventricular myosin light chain 2; CMH10; MFM12; MLC2; MLC-2; MLC-2s/v; MLC-2v; Myosin light chain 2, slow skeletal/ventricular muscle isoform; myosin regulatory light chain 2, ventricular/cardiac muscle isoform; myosin, light chain 2, regulatory, cardiac, slow; myosin, light polypeptide 2, regulatory, cardiac, slow; regulatory light chain of myosin; RLC of myosin; slow cardiac myosin regulatory light chain 2; truncated myosin light chain 2; ventricular myosin light chain 2.

• Gene ID:

  4633

• Reactivity:

  Homo sapiens|Human

• Target:

  Contractile protein that plays a role in heart development and function (By similarity) . Following phosphorylation, plays a role in cross-bridge cycling kinetics and cardiac muscle contraction by increasing myosin lever arm stiffness and promoting myosin head diffusion; as a consequence of the increase in maximum contraction force and calcium sensitivity of contraction force. These events altogether slow down myosin kinetics and prolong duty cycle resulting in accumulated myosins being cooperatively recruited to actin binding sites to sustain thin filament activation as a means to fine-tune myofilament calcium sensitivity to force (By similarity) . During cardiogenesis plays an early role in cardiac contractility by promoting cardiac myofibril assembly (By similarity) .

• Type:

  Protein

• Source:

  E.coli

• Sequence:

  KRAGGANSNVFSMFEQTQIQEFKEAFTIMDQNRDGFIDKNDLRDTFAALGRVNVKNEEIDEMIKEAPGPINFTVFLTMFGEKLKGADPEETILNAFKVFDPEGKGVLKADYVREMLTTQAERFSKEEVDQMFAAFPPDVTGNLDYKNLVHIITHGEE

• Purification:

  Affinity purified using IMAC

• Assay Protocol:

  Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

• Format:

  Liquid or Lyophilized powder

• Buffer:

  If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

• Reconstitution:

  -20°C or -80°C

• Molecular Weight:

  21.8 kDa

• Protein Length:

  Recombinant

• NCBI Gene Symbol:

  MYL2

• Protein Name:

  Myosin regulatory light chain 2, ventricular/cardiac muscle isoform

• Gene Name URL:

  MYL2

• CAS Number:

  9000-83-3