PPBP Recombinant Protein (Human)

CAT:
247-OPCA00792-1MG
Size:
1 mg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
PPBP Recombinant Protein (Human) - image 1

PPBP Recombinant Protein (Human)

  • Gene Name:

    Pro-platelet basic protein
  • Gene Aliases:

    Beta-TG; beta-thromboglobulin; B-TG1; chemokine (C-X-C motif) ligand 7; connective tissue-activating peptide III; CTAP3; CTAPIII; CTAP-III; CXC chemokine ligand 7; C-X-C motif chemokine 7; CXCL7; LA-PF4; LDGF; leukocyte-derived growth factor; low-affinity platelet factor IV; macrophage-derived growth factor; MDGF; NAP-2; neutrophil-activating peptide 2; PBP; platelet basic protein; SCYB7; small inducible cytokine B7; small inducible cytokine subfamily B, member 7; Small-inducible cytokine B7; TC1; TC2; TGB; TGB1; THBGB; THBGB1; thrombocidin 1; thrombocidin 2; thromboglobulin, beta-1.
  • Gene ID:

    5473
  • Reactivity:

    Homo sapiens|Human
  • Target:

    LA-PF4 stimulates DNA synthesis, mitosis, glycolysis, intracellular cAMP accumulation, prostaglandin E2 secretion, and synthesis of hyaluronic acid and sulfated glycosaminoglycan. It also stimulates the formation and secretion of plasminogen activator by human synovial cells. NAP-2 is a ligand for CXCR1 and CXCR2, and NAP-2, NAP-2 (73), NAP-2 (74), NAP-2 (1-66), and most potent NAP-2 (1-63) are chemoattractants and activators for neutrophils. TC-1 and TC-2 are antibacterial proteins, in vitro released from activated platelet alpha-granules. CTAP-III (1-81) is more potent than CTAP-III desensitize chemokine-induced neutrophil activation.
  • Type:

    Protein
  • Source:

    E.coli
  • Sequence:

    AELRCMCIKTTSGIHPKNIQSLEVIGKGTHCNQVEVIATLKDGRKICLDPDAPRIKKIVQKKLAGDE
  • Assay Protocol:

    Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol
  • Format:

    Liquid or Lyophilized powder
  • Buffer:

    If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
  • Reconstitution:

    -20°C or -80°C
  • Molecular Weight:

    34.4 kDa
  • Protein Length:

    Recombinant
  • NCBI Gene Symbol:

    PPBP
  • Protein Name:

    Platelet basic protein
  • Gene Name URL:

    PPBP
  • CAS Number:

    9000-83-3