CXCL5 Recombinant Protein (Human)

CAT:
247-OPCA00630-100UG
Size:
100 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
CXCL5 Recombinant Protein (Human) - image 1

CXCL5 Recombinant Protein (Human)

  • Gene Name:

    C-X-C motif chemokine ligand 5
  • Gene Aliases:

    Chemokine (C-X-C motif) ligand 5; C-X-C motif chemokine 5; ENA-78; ENA-78 (1-78) ; epithelial-derived neutrophil-activating protein 78; neutrophil-activating peptide ENA-78; neutrophil-activating protein 78; SCYB5; small inducible cytokine subfamily B (Cys-X-Cys), member 5 (epithelial-derived neutrophil-activating peptide 78) ; Small-inducible cytokine B5.
  • Gene ID:

    6374
  • Reactivity:

    Homo sapiens|Human
  • Target:

    Involved in neutrophil activation. In vitro, ENA-78 (8-78) and ENA-78 (9-78) show a threefold higher chemotactic activity for neutrophil granulocytes.
  • Type:

    Protein
  • Source:

    E.coli
  • Sequence:

    AGPAAAVLRELRCVCLQTTQGVHPKMISNLQVFAIGPQCSKVEVVASLKNGKEICLDPEAPFLKKVIQKILDGG
  • Assay Protocol:

    Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol
  • Format:

    Liquid or Lyophilized powder
  • Buffer:

    If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
  • Reconstitution:

    -20°C or -80°C
  • Molecular Weight:

    11.9 kDa
  • Protein Length:

    Recombinant
  • NCBI Gene Symbol:

    CXCL5
  • Protein Name:

    C-X-C motif chemokine 5
  • Gene Name URL:

    CXCL5
  • CAS Number:

    9000-83-3