CXCL5 Recombinant Protein (Human)

• Gene Name:

  C-X-C motif chemokine ligand 5

• Gene Aliases:

  Chemokine (C-X-C motif) ligand 5; C-X-C motif chemokine 5; ENA-78; ENA-78 (1-78) ; epithelial-derived neutrophil-activating protein 78; neutrophil-activating peptide ENA-78; neutrophil-activating protein 78; SCYB5; small inducible cytokine subfamily B (Cys-X-Cys), member 5 (epithelial-derived neutrophil-activating peptide 78) ; Small-inducible cytokine B5.

• Gene ID:

  6374

• Reactivity:

  Homo sapiens|Human

• Target:

  Involved in neutrophil activation. In vitro, ENA-78 (8-78) and ENA-78 (9-78) show a threefold higher chemotactic activity for neutrophil granulocytes.

• Type:

  Protein

• Source:

  E.coli

• Sequence:

  AGPAAAVLRELRCVCLQTTQGVHPKMISNLQVFAIGPQCSKVEVVASLKNGKEICLDPEAPFLKKVIQKILDGG

• Assay Protocol:

  Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

• Format:

  Liquid or Lyophilized powder

• Buffer:

  If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

• Reconstitution:

  -20°C or -80°C

• Molecular Weight:

  11.9 kDa

• Protein Length:

  Recombinant

• NCBI Gene Symbol:

  CXCL5

• Protein Name:

  C-X-C motif chemokine 5

• Gene Name URL:

  CXCL5

• CAS Number:

  9000-83-3