ALG2 Recombinant Protein (Human)

CAT:
247-OPCA00557-100UG
Size:
100 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
ALG2 Recombinant Protein (Human) - image 1

ALG2 Recombinant Protein (Human)

  • Gene Name:

    Programmed cell death 6
  • Gene Aliases:

    ALG2; ALG-2; apoptosis-linked gene 2 protein homolog; PEF1B; probable calcium-binding protein ALG-2; programmed cell death protein 6.
  • Gene ID:

    10016
  • Reactivity:

    Homo sapiens|Human
  • Target:

    Calcium sensor that plays a key role in processes such as endoplasmic reticulum (ER) -Golgi vesicular transport, endosomal biogenesis or membrane repair. Acts as an adapter that bridges unrelated proteins or stabilizes weak protein-protein complexes in response to calcium: calcium-binding triggers exposure of apolar surface, promoting interaction with different sets of proteins thanks to 3 different hydrophobic pockets, leading to translocation to membranes (PubMed:20691033, PubMed:25667979) . Involved in ER-Golgi transport by promoting the association between PDCD6IP and TSG101, thereby bridging together the ESCRT-III and ESCRT-I complexes (PubMed:19520058) . Together with PEF1, acts as calcium-dependent adapter for the BCR (KLHL12) complex, a complex involved in ER-Golgi transport by regulating the size of COPII coats (PubMed:27716508) . In response to cytosolic calcium increase, the heterodimer formed with PEF1 interacts with, and bridges together the BCR (KLHL12) complex and SEC31 (SEC31A or SEC31B), promoting monoubiquitination of SEC31 and subsequent collagen export, which is required for neural crest specification (PubMed:27716508) . Involved in the regulation of the distribution and function of MCOLN1 in the endosomal pathway (PubMed:19864416) . Promotes localization and polymerization of TFG at endoplasmic reticulum exit site (PubMed:27813252) . Required for T-cell receptor-, Fas-, and glucocorticoid-induced apoptosis (By similarity) . May mediate Ca (2+) -regulated signals along the death pathway: interaction with DAPK1 can accelerate apoptotic cell death by increasing caspase-3 activity (PubMed:16132846) . Its role in apoptosis may however be indirect, as suggested by knockout experiments (By similarity) . May inhibit KDR/VEGFR2-dependent angiogenesis; the function involves inhibition of VEGF-induced phosphorylation of the Akt signaling pathway (PubMed:21893193) . In case of infection by HIV-1 virus, indirectly inhibits HIV-1 production by affecting viral Gag expression and distribution (PubMed:27784779) .
  • Type:

    Protein
  • Source:

    E.coli
  • Sequence:

    MAAYSYRPGPGAGPGPAAGAALPDQSFLWNVFQRVDKDRSGVISDTELQQALSNGTWTPFNPVTVRSIISMFDRENKAGVNFSEFTGVWKYITDWQNVFRTYDRDNSGMIDKNELKQALSGFGYRLSDQFHDILIRKFDRQGRGQIAFDDFIQGCIVLQRLTDIFRRYDTDQDGWIQVSYEQYLSMVFSIV
  • Assay Protocol:

    Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol
  • Format:

    Liquid or Lyophilized powder
  • Buffer:

    If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
  • Reconstitution:

    -20°C or -80°C
  • Molecular Weight:

    48.9 kDa
  • Protein Length:

    Recombinant
  • NCBI Gene Symbol:

    PDCD6
  • Protein Name:

    Programmed cell death protein 6
  • Gene Name URL:

    PDCD6
  • CAS Number:

    9000-83-3