Products for Research Use Only
RegisterLogin

Recombinant human Negative elongation factor B

CAT: 0247-OPCA00521-100UGSize: 100 µgDry Ice: NoHazardous: No
Product image 1
1 / 1
CAT#:0247-OPCA00521-100UGSize:100 µg
Selected
24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Quick Request Actions
CAS Number
9000-83-3
Gene Name
Negative elongation factor complex member B
Gene Aliases
COBRA1; cofactor of BRCA1; negative elongation factor B; negative elongation factor protein B; NELF-B.
Gene ID
25920
Reactivity
Homo sapiens|Human
Target
Essential component of the NELF complex, a complex that negatively regulates the elongation of transcription by RNA polymerase II. The NELF complex, which acts via an association with the DSIF complex and causes transcriptional pausing, is counteracted by the P-TEFb kinase complex. The NELF complex is involved in HIV-1 latency possibly involving recruitment of PCF11 to paused RNA polymerase II. Binds RNA which may help to stabilize the NELF complex on nucleic acid. In vitro, binds weakly to the HIV-1 TAR RNA which is located in the long terminal repeat (LTR) of HIV-1. May be able to induce chromatin unfolding.
Type
Protein
Source
E.coli
Sequence
LGVANGEDLKETLTNCTEPLKAIEQFQTENGVLLPSLQSALPFLDLHGTPRLEFHQSVFDELRDKLLERVSAIASEGKAEERYKKLEDLLEKSFSLVKMPSLQPVVMCVMKHLPKVPEKKLKLVMADKELYRACAVEVKRQIWQDNQALFGDEVSPLLKQYILEKESALFSTELSVLHNFFSPSPKTRRQGE
Assay Protocol
Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol
Format
Liquid or Lyophilized powder
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
-20°C or -80°C
Molecular Weight
48.9 kDa
Protein Length
Recombinant
NCBI Gene Symbol
NELFB
Protein Name
Negative elongation factor B
Gene Name URL
NELFB

Related Products

CatalogName
OACA01104-100UGRabbit anti-human Negative elongation factor B
OPCA00236-20UGRecombinant human Transcription elongation factor B polypeptide 1
OPCA00236-1MGRecombinant human Transcription elongation factor B polypeptide 1
OPCA00236-100UGRecombinant human Transcription elongation factor B polypeptide 1
OPCA00072-100UGRecombinant human Elongation factor 2
OPCA00072-1MGRecombinant human Elongation factor 2
OPCA00072-20UGRecombinant human Elongation factor 2
OPCA00071-100UGRecombinant human Elongation factor 1-delta
OPCA00071-1MGRecombinant human Elongation factor 1-delta
OPCA00071-20UGRecombinant human Elongation factor 1-delta

Alternative Products

CatalogName
486754NELFA (Negative Elongation Factor A, Negative Elongation Factor Complex Member A)
325508-01Negative elongation factor B
478319COBRA1 (Negative Elongation Factor B, Negative Elongation Factor Complex Member B)
MBS1364713-01Recombinant Human Negative elongation factor A (WHSC2)
MBS717301-01Recombinant Human Negative elongation factor B
325511-01Negative elongation factor B (HRP)
325509-01Negative elongation factor B (Biotin)
FY12827NELFA Antibody / Negative elongation factor A
325510-01Negative elongation factor B (FITC)
abx235656Negative Elongation Factor A (NELFA) Antibody

Popular Products