STARD7 Recombinant Protein (Human)

• Gene Name:

  StAR related lipid transfer domain containing 7

• Gene Aliases:

  FAME2; gestational trophoblastic tumor protein 1; GTT1; StAR-related lipid transfer (START) domain containing 7; stAR-related lipid transfer protein 7, mitochondrial; START domain containing 7; START domain-containing protein 7.

• Gene ID:

  56910

• Reactivity:

  Homo sapiens|Human

• Target:

  May play a protective role in mucosal tissues by preventing exaggerated allergic responses.

• Type:

  Protein

• Source:

  E.coli

• Sequence:

  LWRRLHGRPGHASALMAALAGVFVWDEERIQEEELQRSINEMKRLEEMSNMFQSSGVQHHPPEPKAQTEGNEDSEGKEQRWEMVMDKKHFKLWRRPITGTHLYQYRVFGTYTDVTPRQFFNVQLDTEYRKKWDALVIKLEVIERDVVSGSEVLHWVTHFPYPMYSRDYVYVRRYSVDQENNMMVLVSRAVEHPSVPESPEFVRVRSYESQMVIRPHKSFDENGFDYLLTYSDNPQTVFPRYCVSWMV

• Assay Protocol:

  Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

• Format:

  Liquid or Lyophilized powder

• Buffer:

  If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

• Reconstitution:

  -20°C or -80°C

• Molecular Weight:

  56.5 kDa

• Protein Length:

  Recombinant

• NCBI Gene Symbol:

  STARD7

• Protein Name:

  StAR-related lipid transfer protein 7, mitochondrial

• Gene Name URL:

  STARD7

• CAS Number:

  9000-83-3