Products for Research Use Only
RegisterLogin

DDX39B Recombinant Protein (Human)

CAT: 0247-OPCA00324-100UGSize: 100 µgDry Ice: NoHazardous: No
Product image 1
1 / 1
CAT#:0247-OPCA00324-100UGSize:100 µg
Selected
24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Quick Request Actions
CAS Number
9000-83-3
Gene Name
DExD-box helicase 39B
Gene Aliases
56 kDa U2AF65-associated protein; ATP-dependent RNA helicase p47; BAT1; D6S81E; DEAD (Asp-Glu-Ala-Asp) box polypeptide 39B; DEAD box protein UAP56; DEAD-box helicase 39B; HLA-B-associated transcript 1 protein; nuclear RNA helicase (DEAD family) ; spliceosome RNA helicase BAT1; spliceosome RNA helicase DDX39B; UAP56.
Gene ID
7919
Reactivity
Homo sapiens|Human
Target
Involved in nuclear export of spliced and unspliced mRNA. Assembling component of the TREX complex which is thought to couple mRNA transcription, processing and nuclear export, and specifically associates with spliced mRNA and not with unspliced pre-mRNA. TREX is recruited to spliced mRNAs by a transcription-independent mechanism, binds to mRNA upstream of the exon-junction complex (EJC) and is recruited in a splicing- and cap-dependent manner to a region near the 5' end of the mRNA where it functions in mRNA export to the cytoplasm via the TAP/NFX1 pathway. May undergo several rounds of ATP hydrolysis during assembly of TREX to drive subsequent loading of components such as ALYREF/THOC and CHTOP onto mRNA. The TREX complex is essential for the export of Kaposi's sarcoma-associated herpesvirus (KSHV) intronless mRNAs and infectious virus production. Also associates with pre-mRNA independent of ALYREF/THOC4 and the THO complex. Involved in the nuclear export of intronless mRNA; the ATP-bound form is proposed to recruit export adapter ALYREF/THOC4 to intronless mRNA; its ATPase activity is cooperatively stimulated by RNA and ALYREF/THOC4 and ATP hydrolysis is thought to trigger the dissociation from RNA to allow the association of ALYREF/THOC4 and the NXF1-NXT1 heterodimer. Involved in transcription elongation and genome stability.
Type
Protein
Source
E.coli
Sequence
AENDVDNELLDYEDDEVETAAGGDGAEAPAKKDVKGSYVSIHSSGFRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAILGMDVLCQAKSGMGKTAVFVLATLQQLEPVTGQVSVLVMCHTRELAFQISKEYERFSKYMPNVKVAVFFGGLSIKKDEEVLKKNCPHIVVGTPGRILALARNKSLNLKHIKHFILDECDKMLEQLDMRRDVQEIFRMTPHEKQVMMFSATLSKEIRPVCRKFMQDPMEIFV
Assay Protocol
Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol
Format
Liquid or Lyophilized powder
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
-20°C or -80°C
Molecular Weight
55.2 kDa
Protein Length
Recombinant
NCBI Gene Symbol
DDX39B
Protein Name
Spliceosome RNA helicase DDX39B
Gene Name URL
DDX39B

Related Products

CatalogName
OCOA06839-20UGDDX39B Protein Lysate
OCOA01342-20UGDDX39B Protein Lysate
OAAN02701-50ULDDX39B Antibody
OACA02661-50UGDDX39B Antibody
OAAN02701-200ULDDX39B Antibody
OAAN02701-100ULDDX39B Antibody
OAGA01605-100ULDDX39B Antibody
OACA02661-100UGDDX39B Antibody
OPCA05251-100UGDDX3X Recombinant Protein (Human)
OPCA05251-1MGDDX3X Recombinant Protein (Human)

Alternative Products

CatalogName
ATGP0718-010Recombinant human DDX39B protein
RP009001DDX39B Recombinant Protein (Human)
BLT-00286P-01Human DDX39B (Spliceosome Rna Helicase Ddx39B) - Recombinant Protein
MBS7613050-01Recombinant Human DDX39B
TMPH-02133-01DDX39B Protein, Human, Recombinant (GST)
GTR18885693-01Human DDX39B protein
MBS1407262-01Recombinant Human Spliceosome RNA helicase DDX39B (DDX39B)
RP128405DDX39B Recombinant Protein (Mouse)
abx659773-01Human Spliceosome RNA Helicase DDX39B (DDX39B) Protein
RP197639DDX39B Recombinant Protein (Rat)

Popular Products