Recombinant human Luc7-like protein 3

• Gene Name:

  LUC7 like 3 pre-mRNA splicing factor

• Gene Aliases:

  CAMP regulatory element-associated protein 1; cisplatin resistance-associated-overexpressed protein; CRA; CREAP-1; CRE-associated protein 1; CROP; hLuc7A; LUC7A; LUC7-like 3; luc7-like protein 3; OA48-18; okadaic acid-inducible phosphoprotein OA48-18.

• Gene ID:

  51747

• Reactivity:

  Homo sapiens|Human

• Target:

  Binds cAMP regulatory element DNA sequence. May play a role in RNA splicing.

• Type:

  Protein

• Source:

  E.coli

• Sequence:

  MISAAQLLDELMGRDRNLAPDEKRSNVRWDHESVCKYYLCGFCPAELFTNTRSDLGPCEKIHDENLRKQYEKSSRFMKV

• Assay Protocol:

  Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

• Format:

  Liquid or Lyophilized powder

• Buffer:

  If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

• Reconstitution:

  -20°C or -80°C

• Molecular Weight:

  13.3 kDa

• Protein Length:

  Recombinant

• NCBI Gene Symbol:

  LUC7L3

• Protein Name:

  Luc7-like protein 3

• Gene Name URL:

  LUC7L3

• CAS Number:

  9000-83-3