Recombinant human Interferon alpha-2

CAT:
247-OPCA00279-20UG
Size:
20 µg

For Laboratory Research Only. Not for Clinical or Personal Use.

  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
Recombinant human Interferon alpha-2 - image 1

Recombinant human Interferon alpha-2

  • Gene Name :

    Interferon alpha 2
  • Gene Aliases :

    Alpha-2a interferon; IFNA; IFNA2B; IFN-alpha-2; IFN-alphaA; interferon alpha 2a; interferon alpha 2b; interferon alpha A; interferon alpha-2; Interferon alpha-A; leIF A.
  • Gene ID :

    3440
  • Reactivity :

    Homo sapiens|Human
  • Target :

    Produced by macrophages, IFN-alpha have antiviral activities.
  • Type :

    Protein
  • Source :

    E.coli
  • Sequence :

    CDLPQTHSLGSRRTLMLLAQMRKISLFSCLKDRHDFGFPQEEFGNQFQKAETIPVLHEMIQQIFNLFSTKDSSAAWDETLLDKFYTELYQQLNDLEACVIQGVGVTETPLMKEDSILAVRKYFQRITLYLKEKKYSPCAWEVVRAEIMRSFSLSTNLQESLRSKE
  • Assay Protocol :

    Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol
  • Format :

    Liquid or Lyophilized powder
  • Buffer :

    If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
  • Reconstitution :

    -20°C or -80°C
  • Molecular Weight :

    46.2 kDa
  • Protein Length :

    Recombinant
  • NCBI Gene Symbol :

    IFNA2
  • Protein Name :

    Interferon alpha-2
  • Gene Name URL :

    IFNA2
  • CAS Number :

    9000-83-3

Featured Selection

Popular Products

Discover our most sought-after biotechnology products, trusted by researchers worldwide