Recombinant Mouse Serum amyloid A-2 protein
- Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
- Dry Ice Shipment: No


Recombinant Mouse Serum amyloid A-2 protein
Gene Name:
Serum amyloid A 2Gene Aliases:
AW111173; Sa; Saa1; Saa-2; serum amyloid A 1; serum amyloid A-2 protein.Gene ID:
20209Reactivity:
Mouse|Mus musculusTarget:
Major acute phase reactant. Apolipoprotein of the HDL complex.Type:
ProteinSource:
E.coliSequence:
GFFSFIGEAFQGAGDMWRAYTDMKEAGWKDGDKYFHARGNYDAAQRGPGGVWAAEKISDARESFQEFFGRGHEDTMADQEANRHGRSGKDPNYYRPPGLPAKYPurification:
Affinity purified using IMACAssay Protocol:
Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) ProtocolFormat:
Liquid or Lyophilized powderReconstitution:
-20°C or -80°CMolecular Weight:
15.6 kDaProtein Length:
RecombinantNCBI Gene Symbol:
Saa2Protein Name:
Serum amyloid A-2 proteinGene Name URL:
Saa2CAS Number:
9000-83-3
