Products for Research Use Only
RegisterLogin

Recombinant human RING-box protein 2

CAT: 0247-OPCA00205-20UGSize: 20 µgDry Ice: NoHazardous: No
Product image 1
1 / 1
CAT#:0247-OPCA00205-20UGSize:20 µg
Selected
24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Quick Request Actions
CAS Number
9000-83-3
Gene Name
Ring finger protein 7
Gene Aliases
CKBBP1; CKII beta-binding protein 1; rbx2; regulator of cullins 2; RING finger protein 7; RING-box protein 2; ROC2; SAG; sensitive to apoptosis gene protein; sensitive to apoptosis, zinc RING finger protein SAG, regulator of cullins 2; zinc RING finger protein SAG.
Gene ID
9616
Reactivity
Homo sapiens|Human
Target
Probable component of the SCF (SKP1-CUL1-F-box protein) E3 ubiquitin ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins involved in cell cycle progression, signal transduction and transcription (PubMed:10851089) . CRLs complexes and ARIH1 collaborate in tandem to mediate ubiquitination of target proteins, ARIH1 mediating addition of the first ubiquitin on CRLs targets (By similarity) . Through the RING-type zinc finger, seems to recruit the E2 ubiquitination enzyme to the complex and brings it into close proximity to the substrate. Promotes the neddylation of CUL5 via its interaction with UBE2F. May play a role in protecting cells from apoptosis induced by redox agents.
Type
Protein
Source
E.coli
Sequence
ADVEDGEETCALASHSGSSGSKSGGDKMFSLKKWNAVAMWSWDVECDTCAICRVQVMDACLRCQAENKQEDCVVVWGECNHSFHNCCMSLWVKQNNRCPLCQQDWVVQRIGK
Assay Protocol
Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol
Format
Liquid or Lyophilized powder
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
-20°C or -80°C
Molecular Weight
39.6 kDa
Protein Length
Recombinant
NCBI Gene Symbol
RNF7
Protein Name
RING-box protein 2
Gene Name URL
RNF7

Related Products

CatalogName
OPCA00089-20UGRecombinant human Forkhead box protein P1
OPCA00089-1MGRecombinant human Forkhead box protein P1
OPCA00089-100UGRecombinant human Forkhead box protein P1
OPCA05214-1MGToxin CfTX-1 Recombinant Protein (Box jellyfish)
OPCA05214-100UGToxin CfTX-1 Recombinant Protein (Box jellyfish)
OPCA05214-20UGToxin CfTX-1 Recombinant Protein (Box jellyfish)
OPCA00203-100UGRecombinant human Rhomboid-related protein 2
OPCA00563-20UGRecombinant human protein canopy homolog 2
OPCA00079-100UGRecombinant human ELAV-like protein 2
OPCA00203-1MGRecombinant human Rhomboid-related protein 2

Alternative Products

CatalogName
MBS9420620-01Recombinant Human RING-box protein 2
AP70720-01Recombinant Human RING-box protein 2(RNF7)
RPU58352-01Recombinant Human Ring Box Protein 1 (RBX1)
GTR19025878-01Recombinant Human RING-box protein 2 (RNF7)
MBS2902218Human RNF7 / RING-Box Protein 2 Recombinant Protein
BLT-02601P-01Human RNF7 (Ring-Box Protein 2) - Recombinant Protein
MBS2123842-01Recombinant Ring Box Protein 1 (RBX1)
MBS1393038-01Recombinant Mouse RING-box protein 2 (Rnf7)
R11416mMouse Rnf7 / RING-box protein 2 Recombinant Protein
051424-01Ring Box Protein 1 (RBX1), Recombinant, Human, His-Tag

Popular Products