Recombinant human Regenerating islet-derived protein 3-alpha

• Gene Name:

  Regenerating family member 3 alpha

• Gene Aliases:

  Hepatocarcinoma-intestine-pancreas; hepatointestinal pancreatic protein; HIP; HIP/PAP; human proislet peptide; INGAP; pancreatic beta cell growth factor; pancreatitis-associated protein 1; PAP; PAP homologous protein; PAP1; PAP-H; PBCGF; proliferation-inducing protein 34; proliferation-inducing protein 42; reg III-alpha; REG3; REG-3-alpha; regenerating islet-derived 3 alpha; regenerating islet-derived protein 3-alpha; regenerating islet-derived protein III-alpha; REG-III.

• Gene ID:

  5068

• Reactivity:

  Homo sapiens|Human

• Target:

  Bactericidal C-type lectin which acts exclusively against Gram-positive bacteria and mediates bacterial killing by binding to surface-exposed carbohydrate moieties of peptidoglycan. Regulates keratinocyte proliferation and differentiation after skin injury via activation of EXTL3-PI3K-AKT signaling pathway.

• Type:

  Protein

• Source:

  E.coli

• Sequence:

  EEPQRELPSARIRCPKGSKAYGSHCYALFLSPKSWTDADLACQKRPSGNLVSVLSGAEGSFVSSLVKSIGNSYSYVWIGLHDPTQGTEPNGEGWEWSSSDVMNYFAWERNPSTISSPGHCASLSRSTAFLRWKDYNCNVRLPYVCKFTD

• Purification:

  Affinity purified using AC

• Assay Protocol:

  Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

• Format:

  Liquid or Lyophilized powder

• Reconstitution:

  -20°C or -80°C

• Molecular Weight:

  43.6 kDa

• Protein Length:

  Recombinant

• NCBI Gene Symbol:

  REG3A

• Protein Name:

  Regenerating islet-derived protein 3-alpha

• Gene Name URL:

  REG3A

• CAS Number:

  9000-83-3