Recombinant human PCNA-associated factor

CAT:
247-OPCA00145-1MG
Size:
1 mg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
Recombinant human PCNA-associated factor - image 1

Recombinant human PCNA-associated factor

  • Gene Name :

    PCNA clamp associated factor
  • Gene Aliases :

    HCV NS5A-transactivated protein 9; hepatitis C virus NS5A-transactivated protein 9; KIAA0101; L5; NS5ATP9; OEATC; OEATC1; OEATC-1; overexpressed in anaplastic thyroid carcinoma 1; p15 (PAF) ; p15/PAF; p15PAF; PAF; PAF15; PCNA-associated factor; PCNA-associated factor of 15 kDa; PCNA-clamp-associated factor.
  • Gene ID :

    9768
  • Reactivity :

    Homo sapiens|Human
  • Target :

    PCNA-binding protein that acts as a regulator of DNA repair during DNA replication. Following DNA damage, the interaction with PCNA is disrupted, facilitating the interaction between monoubiquitinated PCNA and the translesion DNA synthesis DNA polymerase eta (POLH) at stalled replisomes, facilitating the bypass of replication-fork-blocking lesions. Also acts as a regulator of centrosome number.
  • Type :

    Protein
  • Source :

    E.coli
  • Sequence :

    MVRTKADSVPGTYRKVVAARAPRKVLGSSTSATNSTSVSSRKAENKYAGGNPVCVRPTPKWQKGIGEFFRLSPKDSEKENQIPEEAGSSGLGKAKRKACPLQPDHTNDEKE
  • Assay Protocol :

    Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol
  • Format :

    Liquid or Lyophilized powder
  • Buffer :

    If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
  • Reconstitution :

    -20°C or -80°C
  • Molecular Weight :

    39 kDa
  • Protein Length :

    Recombinant
  • NCBI Gene Symbol :

    PCLAF
  • Protein Name :

    PCNA-associated factor
  • Gene Name URL :

    PCLAF
  • CAS Number :

    9000-83-3

Featured Selection

Popular Products

Discover our most sought-after biotechnology products, trusted by researchers worldwide