Recombinant human Histone H2A type 1

• Gene Name:

  H2A clustered histone 11|H2A clustered histone 13|H2A clustered histone 15|H2A clustered histone 16|H2A clustered histone 17

• Gene Aliases:

  DJ193B12.1; dJ193B12.9; H2A histone family, member C; H2A histone family, member D; H2A histone family, member I; H2A histone family, member N; H2A histone family, member P; H2A.1; H2A.1b; H2A.i; H2A/c; H2A/d; H2A/i; H2A/n; H2A/p; H2AC11; H2AC13; H2AC14; H2AC15; H2AC16; H2AC17; H2AFC; H2AFD; H2AFI; H2AFN; H2AFP; H2AG; HIST1H2AG; HIST1H2AI; HIST1H2AK; HIST1H2AL; HIST1H2AM; histone 1, H2ag; histone 1, H2ai; histone 1, H2ak; histone 1, H2al; histone 1, H2am; histone cluster 1 H2A family member g; histone cluster 1 H2A family member i; histone cluster 1 H2A family member k; histone cluster 1 H2A family member l; histone cluster 1 H2A family member m; histone cluster 1, H2ag; histone cluster 1, H2ai; histone cluster 1, H2ak; histone cluster 1, H2al; histone cluster 1, H2am; histone H2A type 1; histone H2A type 1-J; histone H2A/p; histone H2A/ptl; pH2A/f.

• Gene ID:

  8329|8330|8332|8336|8969

• Reactivity:

  Homo sapiens|Human

• Target:

  Core component of nucleosome. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling.

• Type:

  Protein

• Source:

  E.coli

• Sequence:

  SGRGKQGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLPNIQAVLLPKKTESHHKAKGK

• Assay Protocol:

  Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

• Format:

  Liquid or Lyophilized powder

• Buffer:

  If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

• Reconstitution:

  -20°C or -80°C

• Molecular Weight:

  18 kDa

• Protein Length:

  Recombinant

• NCBI Gene Symbol:

  H2AC11|H2AC13|H2AC15|H2AC16|H2AC17

• Protein Name:

  Histone H2A type 1

• Gene Name URL:

  H2AC11|H2AC13|H2AC15|H2AC16|H2AC17

• CAS Number:

  9000-83-3