Products for Research Use Only
RegisterLogin

Recombinant human Aldehyde oxidase

CAT: 0247-OPCA00007-20UGSize: 20 µgDry Ice: NoHazardous: No
Product image 1
1 / 1
CAT#:0247-OPCA00007-20UGSize:20 µg
Selected
24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Quick Request Actions
CAS Number
9000-83-3
Gene Name
Aldehyde oxidase 1
Gene Aliases
Aldehyde oxidase; Aldehyde oxidase 1; AO; AOH1; azaheterocycle hydroxylase.
Gene ID
316
Reactivity
Homo sapiens|Human
Target
Oxidase with broad substrate specificity, oxidizing aromatic azaheterocycles, such as N1-methylnicotinamide, N-methylphthalazinium and phthalazine, as well as aldehydes, such as benzaldehyde, retinal, pyridoxal, and vanillin. Plays a key role in the metabolism of xenobiotics and drugs containing aromatic azaheterocyclic substituents. Participates in the bioactivation of prodrugs such as famciclovir, catalyzing the oxidation step from 6-deoxypenciclovir to penciclovir, which is a potent antiviral agent. Is probably involved in the regulation of reactive oxygen species homeostasis. May be a prominent source of superoxide generation via the one-electron reduction of molecular oxygen. Also may catalyze nitric oxide (NO) production via the reduction of nitrite to NO with NADH or aldehyde as electron donor. May play a role in adipogenesis.
Type
Protein
Source
E.coli
Sequence
FGSERMMWFSPVTLKELLEFKFKYPQAPVIMGNTSVGPEVKFKGVFHPVIISPDRIEELSVVNHAYNGLTLGAGLSLAQVKDILADVVQKLPEEKTQMYHALLKHLGTLAGSQIRNMASLGGHIISRHPDSDLNPILAVGNCTLNLLSKEGKRQIPLNEQFLSKCPNADLKPQEILVSVNIPYSRK
Purification
Affinity purified using IMAC
Assay Protocol
Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol
Format
Liquid or Lyophilized powder
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
-20°C or -80°C
Molecular Weight
24.6 kDa
Protein Length
Recombinant
NCBI Gene Symbol
AOX1
Protein Name
Aldehyde oxidase
Gene Name URL
AOX1

Related Products

CatalogName
OPCA00153-100UGRecombinant human Lysyl oxidase homolog 1
OPCA00153-20UGRecombinant human Lysyl oxidase homolog 1
OPCA00153-1MGRecombinant human Lysyl oxidase homolog 1
OPCA00157-1MGRecombinant human Amine oxidase [flavin-containing] B
OPCA00157-20UGRecombinant human Amine oxidase [flavin-containing] B
OPCA00157-100UGRecombinant human Amine oxidase [flavin-containing] B
OPCA00332-20UGRecombinant human Cytochrome c oxidase subunit 5A, mitochondrial
OPCA00332-1MGRecombinant human Cytochrome c oxidase subunit 5A, mitochondrial
OPCA00332-100UGRecombinant human Cytochrome c oxidase subunit 5A, mitochondrial
OPCA00301-20UGRecombinant Arabidopsis thaliana Probable sarcosine oxidase

Alternative Products

CatalogName
MBS9419995-01Recombinant Human Aldehyde oxidase
CSB-EP001858HU-01Recombinant Human Aldehyde oxidase (AOX1), partial
R5988hHuman AOX1 / Aldehyde oxidase Recombinant Protein
SIPQ097Bo01-01Recombinant Aldehyde Oxidase 1 (AOX1)
TP319221LAldehyde Oxidase (AOX1) (NM_001159) Human Recombinant Protein
AP70037-01Recombinant Human Aldehyde oxidase(AOX1 AO), partial
GTR19028022-01Recombinant Human Aldehyde oxidase (AOX1 AO), partial
MBS2883349-01Human Aldehyde oxidase ELISA Kit
MBS958007Recombinant Bovine Aldehyde oxidase (AOX1) , partial
R5988rRat AOX1_ / Aldehyde oxidase Recombinant Protein

Popular Products