CNOT8 Antibody

• Gene Name :

  CCR4-NOT transcription complex subunit 8

• Gene Aliases :

  CAF1, POP2, CALIF, Caf1b, hCAF1

• Gene ID :

  9337

• Swiss Prot :

  Q9UFF9

• Accession Number :

  NP_004770.4

• Reactivity :

  Human, Mouse

• Immunogen :

  Recombinant fusion protein containing a sequence corresponding to amino acids 1-292 of human CNOT8 (NP_004770.4) .

• Target :

  Has 3'-5' poly (A) exoribonuclease activity for synthetic poly (A) RNA substrate. Its function seems to be partially redundant with that of CNOT7. Catalytic component of the CCR4-NOT complex which is linked to various cellular processes including bulk mRNA degradation, miRNA-mediated repression, translational repression during translational initiation and general transcription regulation. During miRNA-mediated repression the complex seems also to act as translational repressor during translational initiation. Additional complex functions may be a consequence of its influence on mRNA expression. Associates with members of the BTG family such as TOB1 and BTG2 and is required for their anti-proliferative activity.

• Clonality :

  Polyclonal

• Type :

  Polyclonal Antibody

• Sequence :

  MPAALVENSQVICEVWASNLEEEMRKIREIVLSYSYIAMDTEFPGVVVRPIGEFRSSIDYQYQLLRCNVDLLKIIQLGLTFTNEKGEYPSGINTWQFNFKFNLTEDMYSQDSIDLLANSGLQFQKHEEEGIDTLHFAELLMTSGVVLCDNVKWLSFHSGYDFGYMVKLLTDSRLPEEEHEFFHILNLFFPSIYDVKYLMKSCKNLKGGLQEVADQLDLQRIGRQHQAGSDSLLTGMAFFRMKELFFEDSIDDAKYCGRLYGLGTGVAQKQNEDVDSAQEKMSILAIINNMQQ

• Applications :

  WB, IHC

• Purification :

  Affinity purified

• Assay Protocol :

  Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

• Format :

  Liquid.// PBS, pH 7.3 with 50% glycerol and 0.02% sodium azide

• Reconstitution :

  Store at -20° C. Avoid freeze / thaw cycles.

• Molecular Weight :

  34 kDa

• Fragment :

  IgG

• NCBI Gene Symbol :

  CNOT8

• Host or Source :

  Rabbit

• Protein Name :

  Syntaxin-7

• Gene Name URL :

  CNOT8

• CAS Number :

  9007-83-4