MGMT Antibody

• Gene Name:

  O-6-methylguanine-DNA methyltransferase

• Gene Aliases:

  6-O-methylguanine-DNA methyltransferase, Methylated-DNA--protein-cysteine methyltransferase, O-6-methylguanine-DNA-alkyltransferase

• Gene ID:

  4255

• Swiss Prot:

  P16455

• Accession Number:

  XP_005252739.1

• Reactivity:

  Human, Mouse, Rat

• Immunogen:

  Recombinant fusion protein containing a sequence corresponding to amino acids 1-207 of human MGMT.

• Target:

  Alkylating agents are potent carcinogens that can result in cell death, mutation and cancer. The protein encoded by this gene is a DNA repair protein that is involved in cellular defense against mutagenesis and toxicity from alkylating agents. The protein catalyzes transfer of methyl groups from O (6) -alkylguanine and other methylated moieties of the DNA to its own molecule, which repairs the toxic lesions. Methylation of the genes promoter has been associated with several cancer types, including colorectal cancer, lung cancer, lymphoma and glioblastoma.

• Clonality:

  Polyclonal

• Type:

  Polyclonal Antibody

• Sequence:

  MDKDCEMKRTTLDSPLGKLELSGCEQGLHEIKLLGKGTSAADAVEVPAPAAVLGGPEPLMQCTAWLNAYFHQPEAIEEFPVPALHHPVFQQESFTRQVLWKLLKVVKFGEVISYQQLAALAGNPKAARAVGGAMRGNPVPILIPCHRVVCSSGAVGNYSGGLAVKEWLLAHEGHRLGKPGLGGSSGLAGAWLKGAGATSGSPPAGRN

• Applications:

  WB, IF

• Purification:

  Affinity purified

• Assay Protocol:

  Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

• Format:

  Liquid.// PBS with 0.02% sodium azide, 50% glycerol, pH 7.3

• Reconstitution:

  Store at -20C. Avoid freeze/thaw cycles.

• Molecular Weight:

  22 kDa

• Fragment:

  IgG

• NCBI Gene Symbol:

  MGMT

• Host or Source:

  Rabbit

• Protein Name:

  Endothelin-1

• Gene Name URL:

  MGMT

• CAS Number:

  9007-83-4

• Nucleotide Accession Number:

  XM_005252682.2