PDGFB Antibody

CAT:
247-OAAN00278-200UL
Size:
200 µL
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
PDGFB Antibody - image 1

PDGFB Antibody

  • Gene Name :

    Platelet derived growth factor subunit B
  • Gene Aliases :

    SIS, SSV, IBGC5, PDGF2, c-sis, PDGF-2
  • Gene ID :

    5155
  • Swiss Prot :

    P01127
  • Accession Number :

    NP_002599.1
  • Reactivity :

    Human, Rat
  • Immunogen :

    A synthetic peptide corresponding to a sequence within amino acids 140-241 of human PDGFB (NP_002599.1) .
  • Target :

    This gene encodes a member of the protein family comprised of both platelet-derived growth factors (PDGF) and vascular endothelial growth factors (VEGF) . The encoded preproprotein is proteolytically processed to generate platelet-derived growth factor subunit B, which can homodimerize, or alternatively, heterodimerize with the related platelet-derived growth factor subunit A. These proteins bind and activate PDGF receptor tyrosine kinases, which play a role in a wide range of developmental processes. Mutations in this gene are associated with meningioma. Reciprocal translocations between chromosomes 22 and 17, at sites where this gene and that for collagen type 1, alpha 1 are located, are associated with dermatofibrosarcoma protuberans, a rare skin tumor. Alternative splicing results in multiple transcript variants.
  • Clonality :

    Polyclonal
  • Conjugation :

    Unconjugated
  • Type :

    Polyclonal Antibody
  • Sequence :

    QCRPTQVQLRPVQVRKIEIVRKKPIFKKATVTLEDHLACKCETVAAARPVTRSPGGSQEQRAKTPQTRVTIRTVRVRRPPKGKHRKFKHTHDKTALKETLGA
  • Applications :

    WB, IHC, IF, ICC
  • Purification :

    Affinity purified
  • Assay Protocol :

    Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol
  • Format :

    Liquid.// PBS, pH 7.3, with 0.05% proclin300 and 50% glycerol
  • Reconstitution :

    Store at -20° C. Avoid repeated freeze/thaw cycles.
  • Molecular Weight :

    27 kDa
  • Fragment :

    IgG
  • NCBI Gene Symbol :

    PDGFB
  • Host or Source :

    Rabbit
  • Protein Name :

    Platelet-derived growth factor subunit B
  • Gene Name URL :

    PDGFB
  • CAS Number :

    9007-83-4
  • Nucleotide Accession Number :

    NM_002608.3