PYCARD Antibody

CAT:
247-OAAN00256-100UL
Size:
100 µL
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
PYCARD Antibody - image 1

PYCARD Antibody

  • Gene Name :

    PYD and CARD domain containing
  • Gene Aliases :

    ASC, TMS, TMS1, CARD5, TMS-1
  • Gene ID :

    29108
  • Swiss Prot :

    Q9ULZ3
  • Accession Number :

    NP_037390.2
  • Reactivity :

    Human, Mouse, Rat
  • Immunogen :

    Recombinant fusion protein containing a sequence corresponding to amino acids 50-195 of human ASC / TMS1 (NP_037390.2) .
  • Target :

    This gene encodes an adaptor protein that is composed of two protein-protein interaction domains: a N-terminal PYRIN-PAAD-DAPIN domain (PYD) and a C-terminal caspase-recruitment domain (CARD) . The PYD and CARD domains are members of the six-helix bundle death domain-fold superfamily that mediates assembly of large signaling complexes in the inflammatory and apoptotic signaling pathways via the activation of caspase. In normal cells, this protein is localized to the cytoplasm; however, in cells undergoing apoptosis, it forms ball-like aggregates near the nuclear periphery. Two transcript variants encoding different isoforms have been found for this gene.
  • Clonality :

    Polyclonal
  • Conjugation :

    Unconjugated
  • Type :

    Polyclonal Antibody
  • Sequence :

    LDLTDKLVSFYLETYGAELTANVLRDMGLQEMAGQLQAATHQGSGAAPAGIQAPPQSAAKPGLHFIDQHRAALIARVTNVEWLLDALYGKVLTDEQYQAVRAEPTNPSKMRKLFSFTPAWNWTCKDLLLQALRESQSYLVEDLERS
  • Applications :

    WB, IF
  • Purification :

    Affinity purification
  • Assay Protocol :

    Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol
  • Format :

    Liquid// PBS with 0.02% sodium azide, 50% glycerol (pH 7.3)
  • Reconstitution :

    Store at -20° C. Avoid repeated freeze/thaw cycles.
  • Molecular Weight :

    22 kDa
  • Fragment :

    IgG
  • NCBI Gene Symbol :

    PYCARD
  • Host or Source :

    Rabbit
  • Protein Name :

    Apoptosis-associated speck-like protein containing a CARD
  • Gene Name URL :

    PYCARD
  • CAS Number :

    9007-83-4
  • Nucleotide Accession Number :

    NM_013258.4