ERBB3 Antibody

CAT:
247-OAAN00137-50UL
Size:
50 µL
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
ERBB3 Antibody - image 1

ERBB3 Antibody

  • Gene Name:

    Erb-b2 receptor tyrosine kinase 3
  • Gene Aliases:

    HER3, FERLK, LCCS2, ErbB-3, c-erbB3, erbB3-S, MDA-BF-1, c-erbB-3, p180-ErbB3, p45-sErbB3, p85-sErbB3
  • Gene ID:

    2065
  • Swiss Prot:

    P21860
  • Accession Number:

    NP_001005915.1
  • Reactivity:

    Human, Mouse, Rat
  • Immunogen:

    Recombinant fusion protein containing a sequence corresponding to amino acids 20-285 of human ERBB3 (NP_001973.2) .
  • Target:

    This gene encodes a member of the epidermal growth factor receptor (EGFR) family of receptor tyrosine kinases. This membrane-bound protein has a neuregulin binding domain but not an active kinase domain. It therefore can bind this ligand but not convey the signal into the cell through protein phosphorylation. However, it does form heterodimers with other EGF receptor family members which do have kinase activity. Heterodimerization leads to the activation of pathways which lead to cell proliferation or differentiation. Amplification of this gene and/or overexpression of its protein have been reported in numerous cancers, including prostate, bladder, and breast tumors. Alternate transcriptional splice variants encoding different isoforms have been characterized. One isoform lacks the intermembrane region and is secreted outside the cell. This form acts to modulate the activity of the membrane-bound form. Additional splice variants have also been reported, but they have not been thoroughly characterized.
  • Clonality:

    Polyclonal
  • Conjugation:

    Unconjugated
  • Type:

    Polyclonal Antibody
  • Sequence:

    SEVGNSQAVCPGTLNGLSVTGDAENQYQTLYKLYERCEVVMGNLEIVLTGHNADLSFLQWIREVTGYVLVAMNEFSTLPLPNLRVVRGTQVYDGKFAIFVMLNYNTNSSHALRQLRLTQLTEILSGGVYIEKNDKLCHMDTIDWRDIVRDRDAEIVVKDNGRSCPPCHEVCKGRCWGPGSEDCQTLTKTICAPQCNGHCFGPNPNQCCHDECAGGCSGPQDTDCFACRHFNDSGACVPRCPQPLVYNKLTFQLEPNPHTKYQYGGV
  • Applications:

    WB
  • Purification:

    Affinity purification
  • Assay Protocol:

    Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol
  • Format:

    Liquid// PBS with 0.02% sodium azide, 50% glycerol (pH 7.3)
  • Reconstitution:

    Store at -20C. Avoid repeated freeze/thaw cycles.
  • Molecular Weight:

    148 kDa
  • Fragment:

    IgG
  • NCBI Gene Symbol:

    ERBB3
  • Host or Source:

    Rabbit
  • Protein Name:

    Receptor tyrosine-protein kinase erbB-3
  • Gene Name URL:

    ERBB3
  • CAS Number:

    9007-83-4
  • Nucleotide Accession Number:

    NM_001005915.1