OR2A2 Antibody

• Gene Name:

  Olfactory receptor family 2 subfamily A member 2

• Gene Aliases:

  Olfactory receptor 2A17; olfactory receptor 2A2; olfactory receptor OR7-11; olfactory receptor, family 2, subfamily A, member 17 pseudogene; olfactory receptor, family 2, subfamily A, member 2 pseudogene; OR2A17P; OR2A2P; OR7-11; OST008.

• Gene ID:

  442361

• Accession Number:

  https://www.ncbi.nlm.nih.gov/protein/NP_001005480.1

• Reactivity:

  Human, Mouse

• Immunogen:

  OR2A2 (NP_001005480.1, 261 a.a. ~ 318 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

• Target:

  Olfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from single coding-exon genes. Olfactory receptors share a 7-transmembrane domain structure with many neurotransmitter and hormone receptors and are responsible for the recognition and G protein-mediated transduction of odorant signals. The olfactory receptor gene family is the largest in the genome. The nomenclature assigned to the olfactory receptor genes and proteins for this organism is independent of other organisms. [provided by RefSeq

• Clonality:

  Monoclonal

• Clone:

  4B10

• Type:

  Monoclonal Antibody

• Sequence:

  PDSNQREEQEKMLSLFHSVLNPMLNPLIYSLRNAQLKGALHRALQRKRSMRTVYGLCL

• Applications:

  Enzyme-linked immunosorbent assay

• Assay Protocol:

  Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

• Format:

  Liquid

• Reconstitution:

  Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.

• Fragment:

  IgG2a Kappa

• NCBI Gene Symbol:

  OR2A2

• Host or Source:

  Mouse

• Protein Name:

  Homo sapiens olfactory receptor family 2 subfamily A member 2 (OR2A2), mRNA|olfactory receptor 2A2 [Homo sapiens]

• Gene Name URL:

  OR2A2

• CAS Number:

  9007-83-4

• Nucleotide Accession Number:

  https://www.ncbi.nlm.nih.gov/nuccore/NM_001005480