MESP2 Antibody

• Gene Name:

  Mesoderm posterior bHLH transcription factor 2

• Gene Aliases:

  BHLHc6; class C basic helix-loop-helix protein 6; mesoderm posterior 2 homolog; mesoderm posterior basic helix-loop-helix transcription factor 2; mesoderm posterior protein 2; SCDO2.

• Gene ID:

  145873

• Accession Number:

  https://www.ncbi.nlm.nih.gov/protein/XP_085261

• Reactivity:

  Human, Mouse

• Immunogen:

  MESP2 (XP_085261, 2 a.a. ~ 125 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

• Target:

  This gene encodes a member of the bHLH family of transcription factors and plays a key role in defining the rostrocaudal patterning of somites via interactions with multiple Notch signaling pathways. This gene is expressed in the anterior presomitic mesoderm and is downregulated immediately after the formation of segmented somites. This gene also plays a role in the formation of epithelial somitic mesoderm and cardiac mesoderm. Mutations in the MESP2 gene cause autosomal recessive spondylocostal dystosis 2 (SCD02) .

• Clonality:

  Monoclonal

• Clone:

  1C8

• Type:

  Monoclonal Antibody

• Sequence:

  AQSPPPQSLLGHDHWIFAQGWGWAGHWDSTSPASSSDSSGSCPCDGARGLPQPQPPSCSSRAAEAAATTPRRARTGPAGGQRQSASEREKLRMRTLARALHELRRFLPPSLAPAGQSLTKIETL

• Applications:

  Enzyme-linked immunosorbent assay|Immunofluorescence

• Assay Protocol:

  Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

• Concentration:

  1 mg/ml

• Format:

  Liquid.// In 1x PBS, pH 7.4

• Reconstitution:

  Store at -20° C or lower. Aliquot to avoid repeated freezing and thawing.

• Molecular Weight:

  26 kDa

• Fragment:

  IgG2a Kappa

• NCBI Gene Symbol:

  MESP2

• Host or Source:

  Mouse

• Protein Name:

  PREDICTED: Homo sapiens mesoderm posterior 2 homolog (mouse) (MESP2), mRNA|PREDICTED: similar to mesoderm posterior 2 [Homo sapiens]

• Gene Name URL:

  MESP2

• CAS Number:

  9007-83-4

• Nucleotide Accession Number:

  https://www.ncbi.nlm.nih.gov/nuccore/XM_085261