MIB2 Antibody

• Gene Name :

  MIB E3 ubiquitin protein ligase 2

• Gene Aliases :

  E3 ubiquitin-protein ligase MIB2; mind bomb homolog 2; mindbomb E3 ubiquitin protein ligase 2; mindbomb homolog 2; novel zinc finger protein; novelzin; putative NF-kappa-B-activating protein 002N; RING-type E3 ubiquitin transferase MIB2; skeletrophin; zinc finger ZZ type with ankyrin repeat domain protein 1; zinc finger, ZZ type with ankyrin repeat domain 1; ZZANK1; ZZZ5.

• Gene ID :

  142678

• Accession Number :

  https://www.ncbi.nlm.nih.gov/protein/AAH37542

• Reactivity :

  Human, Mouse

• Immunogen :

  MIB2 (AAH37542, 381 a.a. ~ 480 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

• Clonality :

  Monoclonal

• Clone :

  3A7

• Type :

  Monoclonal Antibody

• Sequence :

  IGDLDTVKRLQAGHGEWTDDMAPALGRVGKVVKVFGDGNLRVAVAGQRWTFSPSCLVAYRPEEDANLDVAERARENKSSLSVALDKLRAQKSDPEHPGRL

• Applications :

  Enzyme-linked immunosorbent assay

• Assay Protocol :

  Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

• Format :

  Liquid

• Reconstitution :

  Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.

• Fragment :

  IgG2b Kappa

• NCBI Gene Symbol :

  MIB2

• Host or Source :

  Mouse

• Protein Name :

  Homo sapiens mindbomb homolog 2 (Drosophila), mRNA (cDNA clone MGC:40472 IMAGE:5168033), complete cds|MIB2 protein [Homo sapiens]

• Gene Name URL :

  MIB2

• CAS Number :

  9007-83-4

• Nucleotide Accession Number :

  https://www.ncbi.nlm.nih.gov/nuccore/BC037542