RBP7 Antibody

• Gene Name:

  Retinol binding protein 7

• Gene Aliases:

  Cellular retinoic acid-binding protein 4; cellular retinoic acid-binding protein IV; cellular retinol binding protein 7; CRABP4; CRBP4; CRBPIV; putative cellular retinol-binding protein CRBP IV; retinoid-binding protein 7; retinol binding protein 7, cellular.

• Gene ID:

  116362

• Accession Number:

  https://www.ncbi.nlm.nih.gov/protein/NP_443192.1

• Reactivity:

  Human, Mouse

• Immunogen:

  RBP7 (NP_443192.1, 35 a.a. ~ 134 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

• Target:

  Due to its chemical instability and low solubility in aqueous solution, vitamin A requires cellular retinol-binding proteins (CRBPs), such as RBP7, for stability, internalization, intercellular transfer, homeostasis, and metabolism.[supplied by OMIM

• Clonality:

  Monoclonal

• Clone:

  4F4

• Type:

  Monoclonal Antibody

• Sequence:

  KLLKPQKVIEQNGDSFTIHTNSSLRNYFVKFKVGEEFDEDNRGLDNRKCKSLVIWDNDRLTCIQKGEKKNRGWTHWIEGDKLHLEMFCEGQVCKQTFQRA

• Applications:

  Enzyme-linked immunosorbent assay|Immunofluorescence|Western blot

• Assay Protocol:

  Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

• Format:

  Liquid

• Reconstitution:

  Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.

• Fragment:

  IgG2a Kappa

• NCBI Gene Symbol:

  RBP7

• Host or Source:

  Mouse

• Protein Name:

  Homo sapiens retinol binding protein 7 (RBP7), transcript variant 1, mRNA|retinoid-binding protein 7 [Homo sapiens]

• Gene Name URL:

  RBP7

• CAS Number:

  9007-83-4

• Nucleotide Accession Number:

  https://www.ncbi.nlm.nih.gov/nuccore/NM_052960