CMTM5 Antibody

• Gene Name :

  CKLF like MARVEL transmembrane domain containing 5

• Gene Aliases :

  Chemokine-like factor super family 5; chemokine-like factor superfamily member 5; CKLF-like MARVEL transmembrane domain-containing protein 5; CKLFSF5.

• Gene ID :

  116173

• Accession Number :

  https://www.ncbi.nlm.nih.gov/protein/AAH13109

• Reactivity :

  Human, Mouse

• Immunogen :

  CKLFSF5 (AAH13109, 1 a.a. ~ 156 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

• Target :

  This gene belongs to the chemokine-like factor gene superfamily. This family of genes encodes multi-pass membrane proteins that are similar to both the chemokine and the transmembrane 4 superfamilies of signaling molecules. Alternate transcriptional splice variants of this gene, encoding different isoforms, have been characterized. [provided by RefSeq

• Clonality :

  Monoclonal

• Clone :

  2G1-6B10

• Type :

  Monoclonal Antibody

• Sequence :

  MLSARDRRDRHPEEGVVAELQGFAVDKAFLTSHKGILLETELALTLIIFICFTASISAYMAAALLEFFITLAFLFLYATQYYQRFDRINWPCLDFLRCVSAIIIFLVVSFAAVTSRDGAAIAAFVFGIILVSIFAYDAFKIYRTEMAPGASQGDQQ

• Applications :

  Enzyme-linked immunosorbent assay|Western blot

• Assay Protocol :

  Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

• Format :

  Liquid

• Reconstitution :

  Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.

• Fragment :

  IgG1 kappa

• NCBI Gene Symbol :

  CMTM5

• Host or Source :

  Mouse

• Protein Name :

  CKLF-like MARVEL transmembrane domain containing 5 [Homo sapiens]|Homo sapiens CKLF-like MARVEL transmembrane domain containing 5, mRNA (cDNA clone MGC:21625 IMAGE:4214683), complete cds

• Gene Name URL :

  CMTM5

• CAS Number :

  9007-83-4

• Nucleotide Accession Number :

  https://www.ncbi.nlm.nih.gov/nuccore/BC013109