PIGS Antibody

CAT:
247-OAAL00885-100UG
Size:
100 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
PIGS Antibody - image 1

PIGS Antibody

  • CAS Number :

    9007-83-4
  • Gene Name :

    Phosphatidylinositol glycan anchor biosynthesis class S
  • Gene Aliases :

    DEE95; GPI transamidase component PIG-S; GPI transamidase subunit; GPIBD18; phosphatidylinositol glycan, class S; phosphatidylinositol-glycan biosynthesis class S protein.
  • Gene ID :

    94005
  • Accession Number :

    https://www.ncbi.nlm.nih.gov/protein/NP_149975.1
  • Reactivity :

    Human, Mouse
  • Immunogen :

    PIGS (NP_149975.1, 450 a.a. ~ 518 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
  • Target :

    This gene encodes a protein that is involved in GPI-anchor biosynthesis. The glycosylphosphatidylinositol (GPI) anchor is a glycolipid found on many blood cells and serves to anchor proteins to the cell surface. This gene encodes an essential component of the multisubunit enzyme, GPI transamidase. GPI transamidase mediates GPI anchoring in the endoplasmic reticulum, by catalyzing the transfer of fully assembled GPI units to proteins. [provided by RefSeq
  • Clonality :

    Monoclonal
  • Clone :

    3F3
  • Type :

    Monoclonal Antibody
  • Sequence :

    GKISNIVIKDDVASEVYKAVAAVQKSAEELASGHLASAFVASQEAVTSSELAFFDPSLLHLLYFPDDQK
  • Applications :

    Enzyme-linked immunosorbent assay|Western blot
  • Assay Protocol :

    Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol
  • Format :

    Liquid
  • Reconstitution :

    Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
  • Fragment :

    IgG2b Kappa
  • NCBI Gene Symbol :

    PIGS
  • Host or Source :

    Mouse
  • Protein Name :

    GPI transamidase component PIG-S [Homo sapiens]|Homo sapiens phosphatidylinositol glycan anchor biosynthesis class S (PIGS), mRNA
  • Gene Name URL :

    PIGS
  • Nucleotide Accession Number :

    https://www.ncbi.nlm.nih.gov/nuccore/NM_033198

Featured Selection

Popular Products

Discover our most sought-after biotechnology products, trusted by researchers worldwide