PGAP1 Antibody

• Gene Name:

  Post-GPI attachment to proteins inositol deacylase 1

• Gene Aliases:

  Bst1; GPI inositol-deacylase; ISPD3024; MRT42; NEDDSBA; post-GPI attachment to proteins 1; post-GPI attachment to proteins factor 1; SPG67.

• Gene ID:

  80055

• Accession Number:

  https://www.ncbi.nlm.nih.gov/protein/NP_079265

• Reactivity:

  Human, Mouse

• Immunogen:

  PGAP1 (NP_079265, 168 a.a. ~ 266 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

• Target:

  PGAP1 catalyzes the inositol deacylation of glycosylphosphatidylinositol (GPI) at an early step in GPI biosynthesis. Inositol deacylation is essential for the generation of mature GPI capable of attachment to proteins (Tanaka et al., 2004 [PubMed 14734546]) .[supplied by OMIM

• Clonality:

  Monoclonal

• Clone:

  5G6

• Type:

  Monoclonal Antibody

• Sequence:

  VAIIGHSMGGLVARALLTLKNFKHDLINLLITQATPHVAPVMPLDRFITDFYTTVNNYWILNARHINLTTLSVAGGFRDYQVRSGLTFLPKLSHHTSAL

• Applications:

  Enzyme-linked immunosorbent assay

• Assay Protocol:

  Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

• Format:

  Liquid

• Reconstitution:

  Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.

• Fragment:

  IgG1 Kappa

• NCBI Gene Symbol:

  PGAP1

• Host or Source:

  Mouse

• Protein Name:

  GPI inositol-deacylase isoform 1 [Homo sapiens]|Homo sapiens post-GPI attachment to proteins 1 (PGAP1), transcript variant 1, mRNA

• Gene Name URL:

  PGAP1

• CAS Number:

  9007-83-4

• Nucleotide Accession Number:

  https://www.ncbi.nlm.nih.gov/nuccore/NM_024989