PANK2 Antibody

CAT:
247-OAAL00824-100UG
Size:
100 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
PANK2 Antibody - image 1

PANK2 Antibody

  • Gene Name:

    Pantothenate kinase 2
  • Gene Aliases:

    C20orf48; Hallervorden-Spatz syndrome; HARP; HSS; NBIA1; pantothenate kinase 2, mitochondrial; pantothenate kinase-associated neurodegeneration; pantothenic acid kinase 2; PKAN.
  • Gene ID:

    80025
  • Accession Number:

    https://www.ncbi.nlm.nih.gov/protein/NP_705902
  • Reactivity:

    Human, Mouse
  • Immunogen:

    PANK2 (NP_705902, 205 a.a. ~ 259 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
  • Target:

    This gene encodes a protein belonging to the pantothenate kinase family and is the only member of that family to be expressed in mitochondria. Pantothenate kinase is a key regulatory enzyme in the biosynthesis of coenzyme A (CoA) in bacteria and mammalian cells. It catalyzes the first committed step in the universal biosynthetic pathway leading to CoA and is itself subject to regulation through feedback inhibition by acyl CoA species. Mutations in this gene are associated with HARP syndrome and pantothenate kinase-associated neurodegeneration (PKAN), formerly Hallervorden-Spatz syndrome. Alternative splicing, involving the use of alternate first exons, results in multiple transcripts encoding different isoforms. [provided by RefSeq
  • Clonality:

    Monoclonal
  • Clone:

    2B12
  • Type:

    Monoclonal Antibody
  • Sequence:

    IGDLQLCKLDELDCLIKGILYIDSVGFNGRSQCYYFENPADSEKCQKLPFDLKNP
  • Applications:

    Enzyme-linked immunosorbent assay|Immunohistochemistry-Paraffin|Western blot
  • Assay Protocol:

    Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol
  • Format:

    Liquid
  • Reconstitution:

    Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
  • Fragment:

    IgG2a Kappa
  • NCBI Gene Symbol:

    PANK2
  • Host or Source:

    Mouse
  • Protein Name:

    Homo sapiens pantothenate kinase 2 (PANK2), transcript variant 1, mRNA|pantothenate kinase 2, mitochondrial isoform 1 precursor [Homo sapiens]
  • Gene Name URL:

    PANK2
  • CAS Number:

    9007-83-4
  • Nucleotide Accession Number:

    https://www.ncbi.nlm.nih.gov/nuccore/NM_153638