ALG12 Antibody

• Gene Name:

  ALG12 alpha-1,6-mannosyltransferase

• Gene Aliases:

  Asparagine-linked glycosylation 12 homolog (S. cerevisiae, alpha-1,6-mannosyltransferase) ; asparagine-linked glycosylation 12 homolog (yeast, alpha-1,6-mannosyltransferase) ; asparagine-linked glycosylation 12, alpha-1,6-mannosyltransferase homolog; asparagine-linked glycosylation protein 12 homolog; CDG1G; dolichyl-P-Man:Man (7) GlcNAc (2) -PP-dolichol alpha-1,6-mannosyltransferase; dolichyl-P-Man:Man (7) GlcNAc (2) -PP-dolichyl-alpha-1,6-mannosyltransferase; dolichyl-P-mannose:Man-7-GlcNAc-2-PP-dolichyl-alpha-6-mannosyltransferase; dol-P-Man dependent alpha-1,6-mannosyltransferase; dol-P-Man:Man (7) GlcNAc (2) -PP-Dol alpha-1,6-mannosyltransferase; ECM39; hALG12; mannosyltransferase ALG12 homolog; membrane protein SB87; PP14673.

• Gene ID:

  79087

• Accession Number:

  https://www.ncbi.nlm.nih.gov/protein/NP_077010

• Reactivity:

  Human, Mouse, Rat

• Immunogen:

  ALG12 (NP_077010, 369 a.a. ~ 425 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

• Target:

  This gene encodes a member of the glycosyltransferase 22 family. The encoded protein catalyzes the addition of the eighth mannose residue in an alpha-1,6 linkage onto the dolichol-PP-oligosaccharide precursor (dolichol-PP-Man (7) GlcNAc (2) ) required for protein glycosylation. Mutations in this gene have been associated with congenital disorder of glycosylation type Ig (CDG-Ig) characterized by abnormal N-glycosylation. [provided by RefSeq

• Clonality:

  Monoclonal

• Clone:

  5000

• Type:

  Monoclonal Antibody

• Sequence:

  NYPGGVAMQRLHQLVPPQTDVLLHIDVAAAQTGVSRFLQVNSAWRYDKREDVQPGTG

• Applications:

  Enzyme-linked immunosorbent assay|Western blot

• Assay Protocol:

  Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

• Format:

  Liquid

• Reconstitution:

  Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.

• Fragment:

  IgG1 Kappa

• NCBI Gene Symbol:

  ALG12

• Host or Source:

  Mouse

• Protein Name:

  Dol-P-Man:Man (7) GlcNAc (2) -PP-Dol alpha-1,6-mannosyltransferase [Homo sapiens]|Homo sapiens ALG12, alpha-1,6-mannosyltransferase (ALG12), mRNA

• Gene Name URL:

  ALG12

• CAS Number:

  9007-83-4

• Nucleotide Accession Number:

  https://www.ncbi.nlm.nih.gov/nuccore/NM_024105