ACBD3 Antibody

• Gene Name:

  Acyl-CoA binding domain containing 3

• Gene Aliases:

  Acyl-Coenzyme A binding domain containing 3; GCP60; GOCAP1; golgi complex associated protein 1, 60kDa; golgi phosphoprotein 1; Golgi resident protein GCP60; GOLPH1; PAP7; PBR- and PKA-associated protein 7; peripheral benzodiazepine receptor-associated protein PAP7; PKA (RIalpha) -associated protein.

• Gene ID:

  64746

• Accession Number:

  https://www.ncbi.nlm.nih.gov/protein/NP_073572

• Reactivity:

  Human, Mouse, Rat

• Immunogen:

  ACBD3 (NP_073572, 73 a.a. ~ 171 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

• Target:

  The Golgi complex plays a key role in the sorting and modification of proteins exported from the endoplasmic reticulum. The protein encoded by this gene is involved in the maintenance of Golgi structure and function through its interaction with the integral membrane protein giantin. It may also be involved in the hormonal regulation of steroid formation. [provided by RefSeq

• Clonality:

  Monoclonal

• Clone:

  2H2

• Type:

  Monoclonal Antibody

• Sequence:

  RRLEQRWGFGLEELYGLALRFFKEKDGKAFHPTYEEKLKLVALHKQVLMGPYNPDTCPEVGFFDVLGNDRRREWAALGNMSKEDAMVEFVKLLNRCCHL

• Applications:

  Enzyme-linked immunosorbent assay|Immunofluorescence|Western blot

• Assay Protocol:

  Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

• Format:

  Liquid

• Reconstitution:

  Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.

• Fragment:

  IgG1 Kappa

• NCBI Gene Symbol:

  ACBD3

• Host or Source:

  Mouse

• Protein Name:

  Golgi resident protein GCP60 [Homo sapiens]|Homo sapiens acyl-CoA binding domain containing 3 (ACBD3), mRNA

• Gene Name URL:

  ACBD3

• CAS Number:

  9007-83-4

• Nucleotide Accession Number:

  https://www.ncbi.nlm.nih.gov/nuccore/NM_022735