RBAK Antibody

CAT:
247-OAAL00773-100UG
Size:
100 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
RBAK Antibody - image 1

RBAK Antibody

  • Gene Name :

    RB associated KRAB zinc finger
  • Gene Aliases :

    RB-associated KRAB repressor; RB-associated KRAB zinc finger protein; zinc finger protein 769; ZNF769.
  • Gene ID :

    57786
  • Accession Number :

    https://www.ncbi.nlm.nih.gov/protein/NP_066986
  • Reactivity :

    Human, Mouse
  • Immunogen :

    RBAK (NP_066986, 51 a.a. ~ 150 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
  • Target :

    This gene encodes a nuclear protein which interacts with the tumor suppressor retinoblastoma 1. The two interacting proteins are thought to act as a transcriptional repressor for promoters which are activated by the E2F1 transcription factor. This protein contains a Kruppel-associated box (KRAB), which is a transcriptional repressor motif. [provided by RefSeq
  • Clonality :

    Monoclonal
  • Clone :

    6F9
  • Type :

    Monoclonal Antibody
  • Sequence :

    TTKPNVIIKLEQGEEPWIMGGEFPCQHSPEAWRVDDLIERIQENEDKHSRQAACINSKTLTEEKENTFSQIYMETSLVPSSIIAHNCVSCGKNLESISQL
  • Applications :

    Enzyme-linked immunosorbent assay|Western blot
  • Assay Protocol :

    Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol
  • Format :

    Liquid
  • Reconstitution :

    Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
  • Fragment :

    IgG2a Kappa
  • NCBI Gene Symbol :

    RBAK
  • Host or Source :

    Mouse
  • Protein Name :

    Homo sapiens RB associated KRAB zinc finger (RBAK), transcript variant 1, mRNA|RB-associated KRAB zinc finger protein [Homo sapiens]
  • Gene Name URL :

    RBAK
  • CAS Number :

    9007-83-4
  • Nucleotide Accession Number :

    https://www.ncbi.nlm.nih.gov/nuccore/NM_021163

Featured Selection

Popular Products

Discover our most sought-after biotechnology products, trusted by researchers worldwide