BTBD1 Antibody

CAT:
247-OAAL00702-100UG
Size:
100 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
BTBD1 Antibody - image 1

BTBD1 Antibody

  • Gene Name :

    BTB domain containing 1
  • Gene Aliases :

    BTB (POZ) domain containing 1; BTB/POZ domain-containing protein 1; C15orf1; HCV NS5A-transactivated protein 8; hepatitis C virus NS5A-transactivated protein 8; NS5ATP8.
  • Gene ID :

    53339
  • Accession Number :

    https://www.ncbi.nlm.nih.gov/protein/NP_079514
  • Reactivity :

    Human, Mouse
  • Immunogen :

    BTBD1 (NP_079514, 384 a.a. ~ 482 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
  • Target :

    The C-terminus of the protein encoded by this gene binds topoisomerase I. The N-terminus contains a proline-rich region and a BTB/POZ domain (broad-complex, Tramtrack and bric a brac/Pox virus and Zinc finger), both of which are typically involved in protein-protein interactions. Subcellularly, the protein localizes to cytoplasmic bodies. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq
  • Clonality :

    Monoclonal
  • Clone :

    300000000000
  • Type :

    Monoclonal Antibody
  • Sequence :

    EYEKKQTLGQNDTGFSCDGTANTFRVMFKEPIEILPNVCYTACATLKGPDSHYGTKGLKKVVHETPAASKTVFFFFSSPGNNNGTSIEDGQIPEIIFYT
  • Applications :

    Enzyme-linked immunosorbent assay|Western blot
  • Assay Protocol :

    Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol
  • Format :

    Liquid
  • Reconstitution :

    Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
  • Fragment :

    IgG2a Kappa
  • NCBI Gene Symbol :

    BTBD1
  • Host or Source :

    Mouse
  • Protein Name :

    BTB/POZ domain-containing protein 1 isoform 1 [Homo sapiens]|Homo sapiens BTB domain containing 1 (BTBD1), transcript variant 1, mRNA
  • Gene Name URL :

    BTBD1
  • CAS Number :

    9007-83-4
  • Nucleotide Accession Number :

    https://www.ncbi.nlm.nih.gov/nuccore/NM_025238

Featured Selection

Popular Products

Discover our most sought-after biotechnology products, trusted by researchers worldwide