BTBD1 Antibody

• Gene Name:

  BTB domain containing 1

• Gene Aliases:

  BTB (POZ) domain containing 1; BTB/POZ domain-containing protein 1; C15orf1; HCV NS5A-transactivated protein 8; hepatitis C virus NS5A-transactivated protein 8; NS5ATP8.

• Gene ID:

  53339

• Accession Number:

  https://www.ncbi.nlm.nih.gov/protein/NP_079514

• Reactivity:

  Human, Mouse

• Immunogen:

  BTBD1 (NP_079514, 384 a.a. ~ 482 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

• Target:

  The C-terminus of the protein encoded by this gene binds topoisomerase I. The N-terminus contains a proline-rich region and a BTB/POZ domain (broad-complex, Tramtrack and bric a brac/Pox virus and Zinc finger), both of which are typically involved in protein-protein interactions. Subcellularly, the protein localizes to cytoplasmic bodies. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq

• Clonality:

  Monoclonal

• Clone:

  300000000000

• Type:

  Monoclonal Antibody

• Sequence:

  EYEKKQTLGQNDTGFSCDGTANTFRVMFKEPIEILPNVCYTACATLKGPDSHYGTKGLKKVVHETPAASKTVFFFFSSPGNNNGTSIEDGQIPEIIFYT

• Applications:

  Enzyme-linked immunosorbent assay|Western blot

• Assay Protocol:

  Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

• Format:

  Liquid

• Reconstitution:

  Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.

• Fragment:

  IgG2a Kappa

• NCBI Gene Symbol:

  BTBD1

• Host or Source:

  Mouse

• Protein Name:

  BTB/POZ domain-containing protein 1 isoform 1 [Homo sapiens]|Homo sapiens BTB domain containing 1 (BTBD1), transcript variant 1, mRNA

• Gene Name URL:

  BTBD1

• CAS Number:

  9007-83-4

• Nucleotide Accession Number:

  https://www.ncbi.nlm.nih.gov/nuccore/NM_025238