DHDH Antibody

CAT:
247-OAAL00645-100UG
Size:
100 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
DHDH Antibody - image 1

DHDH Antibody

  • Gene Name :

    Dihydrodiol dehydrogenase
  • Gene Aliases :

    2DD;3-deoxyglucosone reductase; dihydrodiol dehydrogenase (dimeric) ; D-xylose 1-dehydrogenase; D-xylose-NADP dehydrogenase; HUM2DD; trans-1,2-dihydrobenzene-1,2-diol dehydrogenase.
  • Gene ID :

    27294
  • Accession Number :

    https://www.ncbi.nlm.nih.gov/protein/NP_055290
  • Reactivity :

    Human, Mouse
  • Immunogen :

    DHDH (NP_055290, 235 a.a. ~ 334 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
  • Target :

    This gene encodes an enzyme that belongs to the family of dihydrodiol dehydrogenases, which exist in multiple forms in mammalian tissues and are involved in the metabolism of xenobiotics and sugars. These enzymes catalyze the NADP1-linked oxidation of transdihydrodiols of aromatic hydrocarbons to corresponding catechols. This enzyme is a dimeric dihydrodiol dehydrogenase, and it differs from monomeric dihydrodiol dehydrogenases in its high substrate specificity for trans-dihydrodiols of aromatic hydrocarbons in the oxidative direction. [provided by RefSeq
  • Clonality :

    Monoclonal
  • Clone :

    3A11
  • Type :

    Monoclonal Antibody
  • Sequence :

    SNTASVSGTKGMAQLLNPCWCPTELVVKGEHKEFPLPPVPKDCNFDNGAGMSYEAKHVWECLRKGMKESPVIPLSESELLADILEEVRKAIGVTFPQDKR
  • Applications :

    Enzyme-linked immunosorbent assay|Western blot
  • Assay Protocol :

    Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol
  • Format :

    Liquid
  • Reconstitution :

    Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
  • Fragment :

    IgG2a Kappa
  • NCBI Gene Symbol :

    DHDH
  • Host or Source :

    Mouse
  • Protein Name :

    Homo sapiens dihydrodiol dehydrogenase (DHDH), mRNA|trans-1,2-dihydrobenzene-1,2-diol dehydrogenase [Homo sapiens]
  • Gene Name URL :

    DHDH
  • CAS Number :

    9007-83-4
  • Nucleotide Accession Number :

    https://www.ncbi.nlm.nih.gov/nuccore/NM_014475

Featured Selection

Popular Products

Discover our most sought-after biotechnology products, trusted by researchers worldwide