DAZAP1 Antibody

CAT:
247-OAAL00637-100UG
Size:
100 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
DAZAP1 Antibody - image 1

DAZAP1 Antibody

  • CAS Number :

    9007-83-4
  • Gene Name :

    DAZ associated protein 1
  • Gene Aliases :

    DAZ-associated protein 1; deleted in azoospermia-associated protein 1; testicular tissue protein Li 50.
  • Gene ID :

    26528
  • Accession Number :

    https://www.ncbi.nlm.nih.gov/protein/NP_061832.2
  • Reactivity :

    Human, Mouse
  • Immunogen :

    DAZAP1 (NP_061832.2, 308 a.a. ~ 407 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
  • Target :

    In mammals, the Y chromosome directs the development of the testes and plays an important role in spermatogenesis. A high percentage of infertile men have deletions that map to regions of the Y chromosome. The DAZ (deleted in azoospermia) gene cluster maps to the AZFc region of the Y chromosome and is deleted in many azoospermic and severely oligospermic men. It is thought that the DAZ gene cluster arose from the transposition, amplification, and pruning of the ancestral autosomal gene DAZL also involved in germ cell development and gametogenesis. This gene encodes a RNA-binding protein with two RNP motifs that was originally identified by its interaction with the infertility factors DAZ and DAZL. Two isoforms are encoded by transcript variants of this gene. [provided by RefSeq
  • Clonality :

    Monoclonal
  • Clone :

    2F6
  • Type :

    Monoclonal Antibody
  • Sequence :

    GVPPPPATPGAAPLAFPPPPSQAAPDMSKPPTAQPDFPYGQYAGYGQDLSGFGQGFSDPSQQPPSYGGPSVPGSGGPPAGGSGFGRGQNHNVQGFHPYRR
  • Applications :

    Enzyme-linked immunosorbent assay|Immunofluorescence|Western blot
  • Assay Protocol :

    Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol
  • Format :

    Liquid
  • Reconstitution :

    Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
  • Fragment :

    IgG1 Kappa
  • NCBI Gene Symbol :

    DAZAP1
  • Host or Source :

    Mouse
  • Protein Name :

    DAZ-associated protein 1 isoform b [Homo sapiens]|Homo sapiens DAZ associated protein 1 (DAZAP1), transcript variant 2, mRNA
  • Gene Name URL :

    DAZAP1
  • Nucleotide Accession Number :

    https://www.ncbi.nlm.nih.gov/nuccore/NM_018959

Featured Selection

Popular Products

Discover our most sought-after biotechnology products, trusted by researchers worldwide