ISCU Antibody

CAT:
247-OAAL00603-100UG
Size:
100 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
ISCU Antibody - image 1

ISCU Antibody

  • Gene Name :

    Iron-sulfur cluster assembly enzyme
  • Gene Aliases :

    2310020H20Rik; HML; hnifU; iron-sulfur cluster assembly enzyme ISCU, mitochondrial; IscU iron-sulfur cluster scaffold homolog; ISU2; NIFU; nifU-like N-terminal domain-containing protein; NIFUN.
  • Gene ID :

    23479
  • Accession Number :

    https://www.ncbi.nlm.nih.gov/protein/AAH11906
  • Reactivity :

    Human, Mouse
  • Immunogen :

    NIFUN (AAH11906, 26 a.a. ~ 167 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
  • Target :

    Iron-sulfur (Fe-S) clusters are necessary for several mitochondrial enzymes and other subcellular compartment proteins. They contain sulfur and iron, and are created via several steps that include cysteine desulfurases, iron donors, chaperones, and scaffold proteins. This gene encodes the two isomeric forms, ISCU1 and ISCU2, of the Fe-S cluster scaffold protein. Mutations in this gene have been found in patients with myopathy with severe exercise intolerance and myoglobinuria. [provided by RefSeq
  • Clonality :

    Monoclonal
  • Clone :

    3B8-1C4
  • Type :

    Monoclonal Antibody
  • Sequence :

    RELSAPARLYHKKVVDHYENPRNVGSLDKTSKNVGTGLVGAPACGDVMKLQIQVDEKGKIVDARFKTFGCGSAIASSSLATEWVKGKTVEEALTIKNTDIAKELCLPPVKLHCSMLAEDAIKAALADYKLKQEPKKGEAEKK
  • Applications :

    Enzyme-linked immunosorbent assay|Immunofluorescence|Western blot
  • Assay Protocol :

    Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol
  • Format :

    Liquid
  • Reconstitution :

    Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
  • Fragment :

    IgG1 kappa
  • NCBI Gene Symbol :

    ISCU
  • Host or Source :

    Mouse
  • Protein Name :

    Homo sapiens iron-sulfur cluster scaffold homolog (E. coli), mRNA (cDNA clone MGC:20315 IMAGE:4136262), complete cds|Iron-sulfur cluster scaffold homolog (E. coli) [Homo sapiens]
  • Gene Name URL :

    ISCU
  • CAS Number :

    9007-83-4
  • Nucleotide Accession Number :

    https://www.ncbi.nlm.nih.gov/nuccore/BC011906

Featured Selection

Popular Products

Discover our most sought-after biotechnology products, trusted by researchers worldwide