MAPRE3 Antibody

• Gene Name:

  Microtubule associated protein RP/EB family member 3

• Gene Aliases:

  APC binding protein; EB1 protein family member 3; EB3; EBF3; EBF3-S; end-binding protein 3; microtubule-associated protein RP/EB family member 3; RP3.

• Gene ID:

  22924

• Accession Number:

  https://www.ncbi.nlm.nih.gov/protein/NP_036458.2

• Reactivity:

  Human, Mouse

• Immunogen:

  MAPRE3 (NP_036458.2, 125 a.a. ~ 218 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

• Target:

  The protein encoded by this gene is a member of the RP/EB family of genes. The protein localizes to the cytoplasmic microtubule network and binds APCL, a homolog of the adenomatous polyposis coli tumor suppressor gene. [provided by RefSeq

• Clonality:

  Monoclonal

• Clone:

  3D7

• Type:

  Monoclonal Antibody

• Sequence:

  NPLLARQGQDVAPPPNPGDQIFNKSKKLIGTAVPQRTSPTGPKNMQTSGRLSNVAPPCILRKNPPSARNGGHETDAQILELNQQLVDLKLTVDG

• Applications:

  Enzyme-linked immunosorbent assay|Immunofluorescence|Western blot

• Assay Protocol:

  Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

• Format:

  Liquid

• Reconstitution:

  Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.

• Fragment:

  IgG2a Kappa

• NCBI Gene Symbol:

  MAPRE3

• Host or Source:

  Mouse

• Protein Name:

  Homo sapiens microtubule associated protein RP/EB family member 3 (MAPRE3), transcript variant 1, mRNA|microtubule-associated protein RP/EB family member 3 [Homo sapiens]

• Gene Name URL:

  MAPRE3

• CAS Number:

  9007-83-4

• Nucleotide Accession Number:

  https://www.ncbi.nlm.nih.gov/nuccore/NM_012326