MAPRE3 Antibody

CAT:
247-OAAL00584-100UG
Size:
100 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
MAPRE3 Antibody - image 1

MAPRE3 Antibody

  • CAS Number :

    9007-83-4
  • Gene Name :

    Microtubule associated protein RP/EB family member 3
  • Gene Aliases :

    APC binding protein; EB1 protein family member 3; EB3; EBF3; EBF3-S; end-binding protein 3; microtubule-associated protein RP/EB family member 3; RP3.
  • Gene ID :

    22924
  • Accession Number :

    https://www.ncbi.nlm.nih.gov/protein/NP_036458.2
  • Reactivity :

    Human, Mouse
  • Immunogen :

    MAPRE3 (NP_036458.2, 125 a.a. ~ 218 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
  • Target :

    The protein encoded by this gene is a member of the RP/EB family of genes. The protein localizes to the cytoplasmic microtubule network and binds APCL, a homolog of the adenomatous polyposis coli tumor suppressor gene. [provided by RefSeq
  • Clonality :

    Monoclonal
  • Clone :

    3D7
  • Type :

    Monoclonal Antibody
  • Sequence :

    NPLLARQGQDVAPPPNPGDQIFNKSKKLIGTAVPQRTSPTGPKNMQTSGRLSNVAPPCILRKNPPSARNGGHETDAQILELNQQLVDLKLTVDG
  • Applications :

    Enzyme-linked immunosorbent assay|Immunofluorescence|Western blot
  • Assay Protocol :

    Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol
  • Format :

    Liquid
  • Reconstitution :

    Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
  • Fragment :

    IgG2a Kappa
  • NCBI Gene Symbol :

    MAPRE3
  • Host or Source :

    Mouse
  • Protein Name :

    Homo sapiens microtubule associated protein RP/EB family member 3 (MAPRE3), transcript variant 1, mRNA|microtubule-associated protein RP/EB family member 3 [Homo sapiens]
  • Gene Name URL :

    MAPRE3
  • Nucleotide Accession Number :

    https://www.ncbi.nlm.nih.gov/nuccore/NM_012326

Featured Selection

Popular Products

Discover our most sought-after biotechnology products, trusted by researchers worldwide