RASA3 Antibody

CAT:
247-OAAL00579-100UG
Size:
100 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
RASA3 Antibody - image 1

RASA3 Antibody

  • Gene Name :

    RAS p21 protein activator 3
  • Gene Aliases :

    GAP1IP4BP; GAPIII; GTPase activating protein III; GTPase-activating protein 1 family, inositol 1,3,4,5-tetrakisphosphate-binding protein; ins P4-binding protein; Ins (1,3,4,5) P4-binding protein; ras GTPase-activating protein 3.
  • Gene ID :

    22821
  • Accession Number :

    https://www.ncbi.nlm.nih.gov/protein/AAH47242
  • Reactivity :

    Human, Mouse
  • Immunogen :

    RASA3 (AAH47242, 725 a.a. ~ 834 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
  • Target :

    The protein encoded by this gene is member of the GAP1 family of GTPase-activating proteins. The gene product stimulates the GTPase activity of normal RAS p21 but not its oncogenic counterpart. Acting as a suppressor of RAS function, the protein enhances the weak intrinsic GTPase activity of RAS proteins resulting in the inactive GDP-bound form of RAS, thereby allowing control of cellular proliferation and differentiation. This family member is an inositol 1,3,4,5-tetrakisphosphate-binding protein, like the closely related RAS p21 protein activator 2. The two family members have distinct pleckstrin-homology domains, with this particular member having a domain consistent with its localization to the plasma membrane. [provided by RefSeq
  • Clonality :

    Monoclonal
  • Clone :

    1F11
  • Type :

    Monoclonal Antibody
  • Sequence :

    DGDRETERIYSLFNLYMSKLEKMQEACGSKSVYDGPEQEEYSTFVIDDPQETYKTLKQVIAGVGALEQEHAQYKRDKFKKTKYGSQEHPIGDKSFQNYIRQQSETSTHSI
  • Applications :

    Enzyme-linked immunosorbent assay|Western blot
  • Assay Protocol :

    Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol
  • Format :

    Liquid
  • Reconstitution :

    Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
  • Fragment :

    IgG2a kappa
  • NCBI Gene Symbol :

    RASA3
  • Host or Source :

    Mouse
  • Protein Name :

    Homo sapiens RAS p21 protein activator 3, mRNA (cDNA clone MGC:47588 IMAGE:6042834), complete cds|RAS p21 protein activator 3 [Homo sapiens]
  • Gene Name URL :

    RASA3
  • CAS Number :

    9007-83-4
  • Nucleotide Accession Number :

    https://www.ncbi.nlm.nih.gov/nuccore/BC047242

Featured Selection

Popular Products

Discover our most sought-after biotechnology products, trusted by researchers worldwide