NPC2 Antibody

CAT:
247-OAAL00530-100UG
Size:
100 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
NPC2 Antibody - image 1

NPC2 Antibody

  • Gene Name :

    NPC intracellular cholesterol transporter 2
  • Gene Aliases :

    EDDM1; epididymal protein 1; epididymis secretory sperm binding protein; HE1; human epididymis-specific protein 1; Niemann-Pick disease type C2 protein; NPC intracellular cholesterol transporter 2; tissue-specific secretory protein.
  • Gene ID :

    10577
  • Accession Number :

    https://www.ncbi.nlm.nih.gov/protein/NP_006423.1
  • Reactivity :

    Human, Mouse
  • Immunogen :

    NPC2 (NP_006423.1, 52 a.a. ~ 151 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
  • Target :

    This gene encodes a protein containing a lipid recognition domain. The encoded protein may function in regulating the transport of cholesterol through the late endosomal/lysosomal system. Mutations in this gene have been associated with Niemann-Pick disease, type C2 and frontal lobe atrophy. [provided by RefSeq
  • Clonality :

    Monoclonal
  • Clone :

    1F4
  • Type :

    Monoclonal Antibody
  • Sequence :

    GQSYSVNVTFTSNIQSKSSKAVVHGILMGVPVPFPIPEPDGCKSGINCPIQKDKTYSYLNKLPVKSEYPSIKLVVEWQLQDDKNQSLFCWEIPVQIVSHL
  • Applications :

    Enzyme-linked immunosorbent assay|Immunoprecipitation
  • Assay Protocol :

    Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol
  • Format :

    Liquid
  • Reconstitution :

    Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
  • Fragment :

    IgG2b Kappa
  • NCBI Gene Symbol :

    NPC2
  • Host or Source :

    Mouse
  • Protein Name :

    Homo sapiens NPC intracellular cholesterol transporter 2 (NPC2), transcript variant 2, mRNA|NPC intracellular cholesterol transporter 2 precursor [Homo sapiens]
  • Gene Name URL :

    NPC2
  • CAS Number :

    9007-83-4
  • Nucleotide Accession Number :

    https://www.ncbi.nlm.nih.gov/nuccore/NM_006432

Featured Selection

Popular Products

Discover our most sought-after biotechnology products, trusted by researchers worldwide