NPC2 Antibody

• Gene Name :

  NPC intracellular cholesterol transporter 2

• Gene Aliases :

  EDDM1; epididymal protein 1; epididymis secretory sperm binding protein; HE1; human epididymis-specific protein 1; Niemann-Pick disease type C2 protein; NPC intracellular cholesterol transporter 2; tissue-specific secretory protein.

• Gene ID :

  10577

• Accession Number :

  https://www.ncbi.nlm.nih.gov/protein/NP_006423.1

• Reactivity :

  Human, Mouse

• Immunogen :

  NPC2 (NP_006423.1, 52 a.a. ~ 151 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

• Target :

  This gene encodes a protein containing a lipid recognition domain. The encoded protein may function in regulating the transport of cholesterol through the late endosomal/lysosomal system. Mutations in this gene have been associated with Niemann-Pick disease, type C2 and frontal lobe atrophy. [provided by RefSeq

• Clonality :

  Monoclonal

• Clone :

  1F4

• Type :

  Monoclonal Antibody

• Sequence :

  GQSYSVNVTFTSNIQSKSSKAVVHGILMGVPVPFPIPEPDGCKSGINCPIQKDKTYSYLNKLPVKSEYPSIKLVVEWQLQDDKNQSLFCWEIPVQIVSHL

• Applications :

  Enzyme-linked immunosorbent assay|Immunoprecipitation

• Assay Protocol :

  Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

• Format :

  Liquid

• Reconstitution :

  Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.

• Fragment :

  IgG2b Kappa

• NCBI Gene Symbol :

  NPC2

• Host or Source :

  Mouse

• Protein Name :

  Homo sapiens NPC intracellular cholesterol transporter 2 (NPC2), transcript variant 2, mRNA|NPC intracellular cholesterol transporter 2 precursor [Homo sapiens]

• Gene Name URL :

  NPC2

• CAS Number :

  9007-83-4

• Nucleotide Accession Number :

  https://www.ncbi.nlm.nih.gov/nuccore/NM_006432