CLEC4M Antibody

CAT:
247-OAAL00512-100UG
Size:
100 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
CLEC4M Antibody - image 1

CLEC4M Antibody

  • CAS Number :

    9007-83-4
  • Gene Name :

    C-type lectin domain family 4 member M
  • Gene Aliases :

    CD209 antigen-like protein 1; CD209L; CD299; CD299 antigen; C-type lectin domain family 4 member M; DC-SIGN2; DCSIGNR; DC-SIGNR; DC-SIGN-related protein; dendritic cell-specific ICAM-3-grabbing non-integrin 2; HP10347; liver/lymph node-specific ICAM-3 grabbing non-integrin; LSIGN; L-SIGN; mannose binding C-type lectin DC-SIGNR.
  • Gene ID :

    10332
  • Accession Number :

    https://www.ncbi.nlm.nih.gov/protein/NP_055072
  • Reactivity :

    Human, Mouse
  • Immunogen :

    CLEC4M (NP_055072, 285 a.a. ~ 394 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
  • Target :

    This gene encodes a transmembrane receptor and is often referred to as L-SIGN because of its expression in the endothelial cells of the lymph nodes and liver. The encoded protein is involved in the innate immune system and recognizes numerous evolutionarily divergent pathogens ranging from parasites to viruses, with a large impact on public health. The protein is organized into three distinct domains: an N-terminal transmembrane domain, a tandem-repeat neck domain and C-type lectin carbohydrate recognition domain. The extracellular region consisting of the C-type lectin and neck domains has a dual function as a pathogen recognition receptor and a cell adhesion receptor by binding carbohydrate ligands on the surface of microbes and endogenous cells. The neck region is important for homo-oligomerization which allows the receptor to bind multivalent ligands with high avidity. Variations in the number of 23 amino acid repeats in the neck domain of this protein are common and have a significant impact on ligand binding ability. This gene is closely related in terms of both sequence and function to a neighboring gene (GeneID 30835; often referred to as DC-SIGN or CD209) . DC-SIGN and L-SIGN differ in their ligand-binding properties and distribution. Alternative splicing results in multiple variants
  • Clonality :

    Monoclonal
  • Clone :

    2G1
  • Type :

    Monoclonal Antibody
  • Sequence :

    SQRNWHDSVTACQEVRAQLVVIKTAEEQNFLQLQTSRSNRFSWMGLSDLNQEGTWQWVDGSPLSPSFQRYWNSGEPNNSGNEDCAEFSGSGWNDNRCDVDNYWICKKPAA
  • Applications :

    Enzyme-linked immunosorbent assay|Western blot
  • Assay Protocol :

    Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol
  • Format :

    Liquid
  • Reconstitution :

    Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
  • Fragment :

    IgG3 Lambda
  • NCBI Gene Symbol :

    CLEC4M
  • Host or Source :

    Mouse
  • Protein Name :

    C-type lectin domain family 4 member M isoform 1 [Homo sapiens]|Homo sapiens C-type lectin domain family 4 member M (CLEC4M), transcript variant 1, mRNA
  • Gene Name URL :

    CLEC4M
  • Nucleotide Accession Number :

    https://www.ncbi.nlm.nih.gov/nuccore/NM_014257

Featured Selection

Popular Products

Discover our most sought-after biotechnology products, trusted by researchers worldwide