MPHOSPH10 Antibody

• Gene Name :

  M-phase phosphoprotein 10

• Gene Aliases :

  CT90; m phase phosphoprotein 10; MPP10; MPP10P; PPP1R106; protein phosphatase 1, regulatory subunit 106; U3 small nucleolar ribonucleoprotein; U3 small nucleolar ribonucleoprotein protein MPP10.

• Gene ID :

  10199

• Accession Number :

  https://www.ncbi.nlm.nih.gov/protein/NP_005782

• Reactivity :

  Human, Mouse

• Immunogen :

  MPHOSPH10 (NP_005782, 348 a.a. ~ 457 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

• Target :

  This gene encodes a protein that is phosphorylated during mitosis. The protein localizes to the nucleolus during interphase and to the chromosomes during M phase. The protein is thought to be part of the U3 small nucleolar ribonucleoprotein complex, which is involved in rRNA processing. [provided by RefSeq

• Clonality :

  Monoclonal

• Clone :

  1000000000000

• Type :

  Monoclonal Antibody

• Sequence :

  NVKKNSDEVKSSFEKRQEKMNEKIASLEKELLEKKPWQLQGEVTAQKRPENSLLEETLHFDHAVRMAPVITEETTLQLEDIIKQRIRDQAWDDVVRKEKPKEDAYEYKKR

• Applications :

  Enzyme-linked immunosorbent assay|Western blot

• Assay Protocol :

  Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

• Format :

  Liquid

• Reconstitution :

  Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.

• Fragment :

  IgG1 Kappa

• NCBI Gene Symbol :

  MPHOSPH10

• Host or Source :

  Mouse

• Protein Name :

  Homo sapiens M-phase phosphoprotein 10 (MPHOSPH10), mRNA|U3 small nucleolar ribonucleoprotein protein MPP10 [Homo sapiens]

• Gene Name URL :

  MPHOSPH10

• CAS Number :

  9007-83-4

• Nucleotide Accession Number :

  https://www.ncbi.nlm.nih.gov/nuccore/NM_005791