SEC24D Antibody

• CAS Number :

  9007-83-4

• Gene Name :

  SEC24 homolog D, COPII coat complex component

• Gene Aliases :

  CLCRP2; protein transport protein Sec24D; SEC24 related gene family, member D; SEC24-related protein D.

• Gene ID :

  9871

• Accession Number :

  https://www.ncbi.nlm.nih.gov/protein/NP_055637

• Reactivity :

  Human, Mouse

• Immunogen :

  SEC24D (NP_055637, 935 a.a. ~ 1032 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

• Target :

  The protein encoded by this gene is a member of the SEC24 subfamily of the SEC23/SEC24 family, which is involved in vesicle trafficking. The encoded protein has similarity to yeast Sec24p component of COPII. COPII is the coat protein complex responsible for vesicle budding from the ER. This gene product is implicated in the shaping of the vesicle, and also in cargo selection and concentration. [provided by RefSeq

• Clonality :

  Monoclonal

• Clone :

  2D4

• Type :

  Monoclonal Antibody

• Sequence :

  SPPELIQGIFNVPSFAHINTDMTLLPEVGNPYSQQLRMIMGIIQQKRPYSMKLTIVKQREQPEMVFRQFLVEDKGLYGGSSYVDFLCCVHKEICQLLN

• Applications :

  Enzyme-linked immunosorbent assay|Western blot

• Assay Protocol :

  Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

• Format :

  Liquid

• Reconstitution :

  Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.

• Fragment :

  IgG1 Kappa

• NCBI Gene Symbol :

  SEC24D

• Host or Source :

  Mouse

• Protein Name :

  Homo sapiens SEC24 homolog D, COPII coat complex component (SEC24D), transcript variant 1, mRNA|protein transport protein Sec24D isoform 1 [Homo sapiens]

• Gene Name URL :

  SEC24D

• Nucleotide Accession Number :

  https://www.ncbi.nlm.nih.gov/nuccore/NM_014822