PTGES Antibody

• Gene Name:

  Prostaglandin E synthase

• Gene Aliases:

  Glutathione peroxidase PTGES; glutathione S-transferase 1-like 1; glutathione transferase PTGES; MGST1L1; MGST1-L1; MGST1-like 1; MGST-IV; microsomal glutathione S-transferase 1-like 1; microsomal prostaglandin E synthase-1; MPGES; mPGES-1; p53-induced apoptosis protein 12; p53-induced gene 12 protein; PGES; PIG12; PP102; PP1294; prostaglandin E synthase; TP53I12; tumor protein p53 inducible protein 12.

• Gene ID:

  9536

• Accession Number:

  https://www.ncbi.nlm.nih.gov/protein/AAH08280.1

• Reactivity:

  Human, Mouse

• Immunogen:

  PTGES (AAH08280.1, 1 a.a. ~ 152 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

• Target:

  The protein encoded by this gene is a glutathione-dependent prostaglandin E synthase. The expression of this gene has been shown to be induced by proinflammatory cytokine interleukin 1 beta (IL1B) . Its expression can also be induced by tumor suppressor protein TP53, and may be involved in TP53 induced apoptosis. Knockout studies in mice suggest that this gene may contribute to the pathogenesis of collagen-induced arthritis and mediate acute pain during inflammatory responses. [provided by RefSeq

• Clonality:

  Monoclonal

• Clone:

  2B9

• Type:

  Monoclonal Antibody

• Sequence:

  MPAHSLVMSSPALPAFLLCSTLLVIKMYVVAIITGQVRLRKKAFANPEDALRHGGPQYCRSDPDVERCLRAHRNDMETIYPFLFLGFVYSFLGPNPFVAWMHFLVFLVGRVAHTVAYLGKLRAPIRSVTYTLAQLPCASMALQILWEAARHL

• Applications:

  Enzyme-linked immunosorbent assay|Immunoprecipitation

• Assay Protocol:

  Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

• Format:

  Liquid

• Reconstitution:

  Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.

• Fragment:

  IgG2b Kappa

• NCBI Gene Symbol:

  PTGES

• Host or Source:

  Mouse

• Protein Name:

  Homo sapiens prostaglandin E synthase, mRNA (cDNA clone MGC:10317 IMAGE:3623516), complete cds|Prostaglandin E synthase [Homo sapiens]

• Gene Name URL:

  PTGES

• CAS Number:

  9007-83-4

• Nucleotide Accession Number:

  https://www.ncbi.nlm.nih.gov/nuccore/BC008280