CYTH3 Antibody

• CAS Number :

  9007-83-4

• Gene Name :

  Cytohesin 3

• Gene Aliases :

  ARF nucleotide-binding site opener 3; ARNO3; cytohesin-3; general receptor of phosphoinositides 1; GRP1; PH, SEC7 and coiled-coil domain-containing protein 3; pleckstrin homology, Sec7 and coiled-coil domains 3; PSCD3.

• Gene ID :

  9265

• Accession Number :

  https://www.ncbi.nlm.nih.gov/protein/AAH08191

• Reactivity :

  Human, Mouse

• Immunogen :

  PSCD3 (AAH08191, 1 a.a. ~ 180 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

• Target :

  This gene encodes a member of the PSCD (pleckstrin homology, Sec7 and coiled-coil domains) family. PSCD family members have identical structural organization that consists of an N-terminal coiled-coil motif, a central Sec7 domain, and a C-terminal pleckstrin homology (PH) domain. The coiled-coil motif is involved in homodimerization, the Sec7 domain contains guanine-nucleotide exchange protein (GEP) activity, and the PH domain interacts with phospholipids and is responsible for association of PSCDs with membranes. Members of this family appear to mediate the regulation of protein sorting and membrane trafficking. This encoded protein is involved in the control of Golgi structure and function, and it may have a physiological role in regulating ADP-ribosylation factor protein 6 (ARF) functions, in addition to acting on ARF1. [provided by RefSeq

• Clonality :

  Monoclonal

• Clone :

  6D3-1A9

• Type :

  Monoclonal Antibody

• Sequence :

  MNRGINEGGDLPEELLRNLYESIKNEPFKIPEDDGNDLTHTFFNPDREGWLLKLGGRVKTWKRRWFILTDNCLYYFEYTTDKEPRGIIPLENLSIREVEDPRKPNCFELYNPSHKGQVIKACKTEADGRVVEGNHVVYRISAPSPEEKEEWMKSIKASISRDPFYDMLATRKRRIANKK*

• Applications :

  Enzyme-linked immunosorbent assay|Immunofluorescence|Western blot

• Assay Protocol :

  Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

• Format :

  Liquid

• Reconstitution :

  Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.

• Fragment :

  IgG2b kappa

• NCBI Gene Symbol :

  CYTH3

• Host or Source :

  Mouse

• Protein Name :

  CYTH3 protein [Homo sapiens]|Homo sapiens cytohesin 3, mRNA (cDNA clone IMAGE:2984886), complete cds

• Gene Name URL :

  CYTH3

• Nucleotide Accession Number :

  https://www.ncbi.nlm.nih.gov/nuccore/BC008191